Navigationsweiche Anfang

Navigationsweiche Ende

Select language

{"scientists":[{"uid":1094,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/dania-achermann.html","title":"Ms. Jun.-Prof. Dr. Achermann, Dania","name":"Achermann Dania","faculty":1,"luf":"Wissenschaftsgeschichte"},{"uid":1012,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/denise-albert.html","title":"Ms. Albert, Denise","name":"Albert Denise","faculty":2,"luf":"Sportdidktik"},{"uid":1110,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tanja-amado.html","title":"Ms. Amado, Tanja","name":"Amado Tanja","faculty":8,"luf":"Kunstdidaktik"},{"uid":107,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/bruno-arich-gerz.html","title":"Mr. Dr. Arich-Gerz, Bruno","name":"Arich-Gerz Bruno","faculty":1,"luf":"Postcolonial Languages Studies"},{"uid":121,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/laia-arnaus-gil.html","title":"Ms. Dr. Arnaus Gil, Laia","name":"Arnaus Gil Laia","faculty":1,"luf":"Fr\u00fchkindliche Mehrsprachigkeit"},{"uid":1196,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/lukas-arnold.html","title":"Mr. Univ-Prof. Dr. Arnold, Lukas","name":"Arnold Lukas","faculty":5,"luf":"Computational Civil Engineering"},{"uid":760,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/schaugar-azad.html","title":"Mr. Dr. Azad, Schaugar","name":"Azad Schaugar","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":992,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/david-bachtenkirch.html","title":"Mr. Bachtenkirch, David","name":"Bachtenkirch David","faculty":3,"luf":"Wirtschaftsinforamtik und Operations Research"},{"uid":403,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/eckart-balz.html","title":"Mr. Prof. Dr. Balz, Eckart","name":"Balz Eckart","faculty":2,"luf":"Sportp\u00e4dagogik"},{"uid":129,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marcus-baer.html","title":"Mr. Prof. Dr. B\u00e4r, Marcus","name":"B\u00e4r Marcus","faculty":1,"luf":"Didaktik des Spanischen"},{"uid":898,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/heike-baranzke-1.html","title":"Ms. Dr. Baranzke, Heike","name":"Baranzke Heike","faculty":1,"luf":0},{"uid":399,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andreas-bartel.html","title":"Mr. Dr. Bartel, Andreas","name":"Bartel Andreas","faculty":4,"luf":"Angewandte Mathematik"},{"uid":193,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/uli-barth.html","title":"Mr. Univ.-Prof Dr.-Ing. Barth, Uli","name":"Barth Uli","faculty":7,"luf":"Methoden der Sicherheitstechnik \/ Unfallforschung"},{"uid":159,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christian-baumgart.html","title":"Mr. Dr. Baumgart, Christian","name":"Baumgart Christian","faculty":2,"luf":"Bewegungs- und Trainingswissenschaft"},{"uid":365,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jonathan-bechem.html","title":"Mr. Bechem, Jonathan","name":"Bechem Jonathan","faculty":7,"luf":"Methoden der Sicherheitstechnik \/ Unfallforschung"},{"uid":523,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/maria-behrens.html","title":"Ms. Prof. Dr. Behrens, Maria","name":"Behrens Maria","faculty":2,"luf":"Internationale Beziehungen und vergleichende Politikwissenschaften"},{"uid":529,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/maria-behrens-1.html","title":"Ms. Prof. Dr. Behrens, Maria","name":"Behrens Maria","faculty":30,"luf":0},{"uid":924,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ralf-benoelken.html","title":"Mr. Prof. Dr. Ben\u00f6lken, Ralf","name":"Ben\u00f6lken Ralf","faculty":4,"luf":"Didaktik der Mathematik"},{"uid":249,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/thorsten-benter.html","title":"Mr. Univ-Prof. Dr. Benter, Thorsten","name":"Benter Thorsten","faculty":4,"luf":"physical chemistry, mass spectrometry and plasmas"},{"uid":99,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/malin-johanna-berges.html","title":"Ms. Berges, Malin Johanna","name":"Berges Malin Johanna","faculty":5,"luf":"Bauphysik und Technische Geb\u00e4udeausr\u00fcstung"},{"uid":243,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andre-betzer.html","title":"Mr. Univ.-Prof. Betzer, Andr\u00e9","name":"Betzer Andr\u00e9","faculty":3,"luf":"Finanzwirtschaft und Corporate Governance"},{"uid":806,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/melanie-beudels.html","title":"Ms. Beudels, Melanie","name":"Beudels Melanie","faculty":4,"luf":"Chloroplastengenom-Analysen, Intron-Analysen, Ciliaten als biologischer Filter in Kl\u00e4ranlagen, Algen als Symbiosen in Meeresnacktschnecken"},{"uid":435,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/manuel-beyen.html","title":"Mr. Beyen, Manuel","name":"Beyen Manuel","faculty":5,"luf":"Stra\u00dfenverkehrsplanung und -technik"},{"uid":854,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/vera-beyer.html","title":"Ms. PD Dr. Beyer, Vera","name":"Beyer Vera","faculty":8,"luf":"Gestaltungstechnik und Kunstgeschichte"},{"uid":325,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ovidiu-bielefeld.html","title":"Mr. Bielefeld, Ovidiu","name":"Bielefeld Ovidiu","faculty":7,"luf":"Produktsicherheit und Qualit\u00e4tswesen"},{"uid":117,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/mustafa-bilgin.html","title":"Mr. Bilgin, Mustafa","name":"Bilgin Mustafa","faculty":6,"luf":"Internet der Dinge"},{"uid":944,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/bjoern-blankenheim.html","title":"Mr. Dr. Blankenheim, Bj\u00f6rn","name":"Blankenheim Bj\u00f6rn","faculty":8,"luf":"Gestaltungstechnik und Kunstgeschichte"},{"uid":359,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-bluem.html","title":"Mr. Dr.-Ing. Bl\u00fcm, Michael","name":"Bl\u00fcm Michael","faculty":7,"luf":"Neue Fertigungsverfahren und Werkstoffe"},{"uid":113,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stefan-bock.html","title":"Mr. Univ-Prof. Dr. Bock, Stefan","name":"Bock Stefan","faculty":3,"luf":"Wirtschaftsinforamtik und Operations Research"},{"uid":579,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/frauke-bode.html","title":"Ms. Dr. Bode, Frauke","name":"Bode Frauke","faculty":1,"luf":"Romanistische Literaturwissenschaft"},{"uid":816,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christoph-bodtlaender.html","title":"Mr. Bodtl\u00e4nder, Christoph","name":"Bodtl\u00e4nder Christoph","faculty":7,"luf":"Didaktik der Technik"},{"uid":343,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/florian-boge.html","title":"Mr. Boge, Florian","name":"Boge Florian","faculty":1,"luf":"Philosophie der Physik"},{"uid":1050,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-boehnke.html","title":"Mr. Univ-Prof. Dr. B\u00f6hnke, Michael","name":"B\u00f6hnke Michael","faculty":1,"luf":"Systematische Theologie"},{"uid":892,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anette-boettcher-1.html","title":"Ms. Dr. B\u00f6ttcher, Anette","name":"B\u00f6ttcher Anette","faculty":2,"luf":"Integrative Theorie und Praxis des Sports"},{"uid":439,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/miriam-boettner.html","title":"Ms. B\u00f6ttner, Miriam","name":"B\u00f6ttner Miriam","faculty":2,"luf":"Kindheitssoziologie"},{"uid":603,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/martina-braasch.html","title":"Ms. Dr. Braasch, Martina","name":"Braasch Martina","faculty":9,"luf":"Lehr-, Lern- und Unterrichsforschung"},{"uid":1116,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kamil-braschke-2.html","title":"Mr. Braschke, Kamil","name":"Braschke Kamil","faculty":7,"luf":"Str\u00f6mungs- und Thermodynamik"},{"uid":401,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/florian-brauner.html","title":"Mr. Dr.-Ing. Brauner, Florian","name":"Brauner Florian","faculty":7,"luf":"3D-Druck & Additive Fertigung"},{"uid":141,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/heiko-breitsohl.html","title":"Mr. Prof. Dr. Breitsohl, Heiko","name":"Breitsohl Heiko","faculty":3,"luf":"Organizational Behavior"},{"uid":986,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ute-breitsohl.html","title":"Ms. Dr. Breitsohl, Ute","name":"Breitsohl Ute","faculty":3,"luf":"Personalmanagement"},{"uid":549,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andreas-bresser.html","title":"Mr. Bresser, Andreas","name":"Bresser Andreas","faculty":5,"luf":"Baubetrieb und Bauwirtschaft"},{"uid":373,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/carsten-breul.html","title":"Mr. Univ-Prof. Dr. Breul, Carsten","name":"Breul Carsten","faculty":1,"luf":"Anglistik: Kontrastive Linguistik"},{"uid":233,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/norbert-brieden.html","title":"Mr. Jun.-Prof. Brieden, Norbert","name":"Brieden Norbert","faculty":1,"luf":"Religionsp\u00e4dagogik \/ Katechetik und Didaktik des Kath. Religionsunterrichts"},{"uid":585,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/dirk-briskorn.html","title":"Mr. Briskorn, Dirk","name":"Briskorn Dirk","faculty":3,"luf":"Produktion und Logistik"},{"uid":1136,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/albrecht-brockhaus.html","title":"Mr. Dr. Brockhaus, Albrecht","name":"Brockhaus Albrecht","faculty":6,"luf":"Elektronik"},{"uid":926,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stefan-bruees.html","title":"Mr. Univ-Prof. Dr. Br\u00fces, Stefan","name":"Br\u00fces Stefan","faculty":6,"luf":"Digitale Medien"},{"uid":936,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/rainer-brunnert.html","title":"Mr. Brunnert, Rainer","name":"Brunnert Rainer","faculty":4,"luf":"Didaktik der Chemie"},{"uid":818,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/gunnar-bruns.html","title":"Mr. Bruns, Gunnar","name":"Bruns Gunnar","faculty":9,"luf":"Sonderp\u00e4dagogik"},{"uid":81,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/susanne-buch.html","title":"Ms. Prof. Dr. Buch, Susanne","name":"Buch Susanne","faculty":9,"luf":"P\u00e4dagogische Diagnostik"},{"uid":810,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/leandra-bucher.html","title":"Ms. Dr. Bucher, Leandra","name":"Bucher Leandra","faculty":2,"luf":"Psychologie"},{"uid":605,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/petra-buchwald.html","title":"Ms. Prof. Dr. Buchwald, Petra","name":"Buchwald Petra","faculty":9,"luf":"Schulp\u00e4dagogik"},{"uid":167,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/axel-buether.html","title":"Mr. Prof. Dr. Buether, Axel","name":"Buether Axel","faculty":8,"luf":"Designwissenschaft"},{"uid":1158,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/bernd-buehlbaecker.html","title":"Mr. Dr. B\u00fchlb\u00e4cker, Bernd","name":"B\u00fchlb\u00e4cker Bernd","faculty":1,"luf":"Neuere Geschichte"},{"uid":441,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/doris-buehler-niederberger.html","title":"Ms. Prof. Dr. B\u00fchler-Niederberger, Doris","name":"B\u00fchler-Niederberger Doris","faculty":2,"luf":"Kindheitssoziologie"},{"uid":209,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/markus-buerger.html","title":"Mr. Dr. B\u00fcrger, Markus","name":"B\u00fcrger Markus","faculty":7,"luf":"Str\u00f6mungs- und Thermodynamik"},{"uid":87,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sebastian-burgmann.html","title":"Mr. Dr.-Ing. Burgmann, Sebastian","name":"Burgmann Sebastian","faculty":7,"luf":"Str\u00f6mungs- und Thermodynamik"},{"uid":341,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/miguel-angel-carretero-sahuquillo.html","title":"Mr. Carretero Sahuquillo, Miguel \u00c1ngel","name":"Carretero Sahuquillo Miguel \u00c1ngel","faculty":1,"luf":"Philosophie der Physik"},{"uid":870,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/rita-casale.html","title":"Ms. Univ-Prof. Dr. Casale, Rita","name":"Casale Rita","faculty":2,"luf":"Bildungsphilosophie und Bildungsgeschichte"},{"uid":397,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/cristin-chall.html","title":"Mr. Chall, Cristin","name":"Chall Cristin","faculty":4,"luf":"Philosophie der Physik"},{"uid":219,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/matei-chihaia.html","title":"Mr. Prof. Dr. Chihaia, Matei","name":"Chihaia Matei","faculty":1,"luf":"Romanistische Literaturwissenschaft"},{"uid":353,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kevin-christopher-cibis.html","title":"Mr. Cibis, Kevin Christopher","name":"Cibis Kevin Christopher","faculty":6,"luf":"Energietechnik"},{"uid":467,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/markus-clemens.html","title":"Mr. Prof. Dr. Clemens, Markus","name":"Clemens Markus","faculty":6,"luf":"elektromagnetische Vertr\u00e4glichkeit unter Umweltaspekten"},{"uid":804,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/katarina-colomo.html","title":"Ms. Dr. Colomo, Katarina","name":"Colomo Katarina","faculty":1,"luf":"Germanistische Sprachwissenschaft"},{"uid":53,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/nils-crasselt.html","title":"Mr. Prof. Dr. Crasselt, Nils","name":"Crasselt Nils","faculty":3,"luf":"Controllling"},{"uid":1162,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/carolin-creson.html","title":"Ms. Creson, Carolin","name":"Creson Carolin","faculty":7,"luf":"3D-Druck & Additive Fertigung"},{"uid":327,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/benedikt-dahlmann.html","title":"Mr. Dr. Dahlmann, Benedikt","name":"Dahlmann Benedikt","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":770,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/petros-dalamaras.html","title":"Mr. Dalamaras, Petros","name":"Dalamaras Petros","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":1138,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sarah-lena-debus.html","title":"Ms. Debus, Sarah-Lena","name":"Debus Sarah-Lena","faculty":6,"luf":"Druckverfahrenstechnik"},{"uid":724,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jasmin-decristan.html","title":"Ms. Prof. Dr. Decristan, Jasmin","name":"Decristan Jasmin","faculty":9,"luf":"Schulische Interventionsforschung bei besonderen p\u00e4dagogischen Bed\u00fcrfnissen"},{"uid":189,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/maria-degeling.html","title":"Ms. Dr. Degeling, Maria","name":"Degeling Maria","faculty":9,"luf":"Didaktik der Mathematik"},{"uid":920,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marieke-dettmann.html","title":"Ms. Dettmann, Marieke","name":"Dettmann Marieke","faculty":7,"luf":"Arbeitswissenschaft \/ Arbeitsmedizin"},{"uid":285,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/baerbel-diehr.html","title":"Ms. Prof. Dr. Diehr, B\u00e4rbel","name":"Diehr B\u00e4rbel","faculty":1,"luf":"Didaktik des Englischen"},{"uid":493,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/felicitas-dopatka.html","title":"Ms. Dopatka, Felicitas","name":"Dopatka Felicitas","faculty":9,"luf":"Sonderp\u00e4dagogische Psychologie"},{"uid":239,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/etienne-doublier.html","title":"Mr. Dr. Doublier, Etienne","name":"Doublier Etienne","faculty":1,"luf":"Mittelalterliche Geschichte"},{"uid":295,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/markus-doumet.html","title":"Mr. Jun.-Prof. Doumet, Markus","name":"Doumet Markus","faculty":3,"luf":"Finanzwirtschaft und Corporate Governance"},{"uid":569,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jean-baptist-du-prel.html","title":"Mr. Dr. du Prel, Jean-Baptist","name":"du Prel Jean-Baptist","faculty":7,"luf":"Arbeitswissenschaft \/ Arbeitsmedizin"},{"uid":876,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stephan-duerr.html","title":"Mr. PD Dr. D\u00fcrr, Stephan","name":"D\u00fcrr Stephan","faculty":4,"luf":"Theoretische Elementarteilchenphysik"},{"uid":778,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/benjamin-dymel-2.html","title":"Mr. Dymel, Benjamin","name":"Dymel Benjamin","faculty":7,"luf":"Mechatronik"},{"uid":764,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/melanie-ebener.html","title":"Ms. Ebener, Melanie","name":"Ebener Melanie","faculty":7,"luf":"Arbeitswissenschaft \/ Arbeitsmedizin"},{"uid":1036,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/georg-eckert.html","title":"Mr. PD Dr. Eckert, Georg","name":"Eckert Georg","faculty":1,"luf":"Neuere Geschichte"},{"uid":1146,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/inga-effert.html","title":"Ms. Dr. Effert, Inga","name":"Effert Inga","faculty":1,"luf":"Religionsp\u00e4dagogik und Didaktik der Ev. Religionslehre"},{"uid":960,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christian-efing-2.html","title":"Mr. Univ-Prof. Dr. Efing, Christian","name":"Efing Christian","faculty":1,"luf":"Didaktik der deutschen Sprache und Literatur (Sprachdidaktik)"},{"uid":275,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/birgit-ehl.html","title":"Ms. Ehl, Birgit","name":"Ehl Birgit","faculty":9,"luf":"Bildungssprache, Sprache im Fachunterricht"},{"uid":217,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/matthias-ehrhardt.html","title":"Mr. Prof. Dr. Ehrhardt, Matthias","name":"Ehrhardt Matthias","faculty":4,"luf":"Angewandte Mathematik"},{"uid":1064,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/armin-eich.html","title":"Mr. Prof. Dr. Eich, Armin","name":"Eich Armin","faculty":1,"luf":"Alte Geschichte"},{"uid":271,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/norbert-eicker.html","title":"Mr. Prof. Dr. Eicker, Norbert","name":"Eicker Norbert","faculty":4,"luf":"Parallele Hard- und Softwaresysteme"},{"uid":1062,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/frank-ellinghaus.html","title":"Mr. PD Dr. Ellinghaus, Frank","name":"Ellinghaus Frank","faculty":4,"luf":"Chemie"},{"uid":662,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/thomas-erlach.html","title":"Mr. Univ-Prof. Dr. Erlach, Thomas","name":"Erlach Thomas","faculty":1,"luf":"Didaktik der Musik"},{"uid":205,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kurt-erlemann.html","title":"Mr. Prof. Dr. Erlemann, Kurt","name":"Erlemann Kurt","faculty":1,"luf":"Neues Testament, Geschichte der Alten Kirche"},{"uid":211,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/uwe-fechter.html","title":"Mr. Fechter, Uwe","name":"Fechter Uwe","faculty":7,"luf":"Str\u00f6mungs- und Thermodynamik"},{"uid":267,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christian-dominic-fehling.html","title":"Mr. Fehling, Christian Dominic","name":"Fehling Christian Dominic","faculty":6,"luf":"Berufsbildungsforschung"},{"uid":980,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tobias-flick.html","title":"Mr. Dr. Flick, Tobias","name":"Flick Tobias","faculty":4,"luf":"Detektorentwicklung"},{"uid":301,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/carolin-frank.html","title":"Ms. Univ-Prof. Dr. Frank, Carolin","name":"Frank Carolin","faculty":7,"luf":"Didaktik der Technik"},{"uid":748,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/felix-franke.html","title":"Mr. Franke, Felix","name":"Franke Felix","faculty":5,"luf":"Stra\u00dfenverkehrsplanung und -technik"},{"uid":958,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/nadine-franken-1.html","title":"Ms. Franken, Nadine","name":"Franken Nadine","faculty":4,"luf":"Chloroplastengenom-Analysen, Intron-Analysen, Ciliaten als biologischer Filter in Kl\u00e4ranlagen, Algen als Symbiosen in Meeresnacktschnecken"},{"uid":716,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/philipp-franz.html","title":"Mr. Franz, Philipp","name":"Franz Philipp","faculty":7,"luf":"Sicherheitstechnik \/ Arbeitssicherheit"},{"uid":499,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/juergen-freiwald.html","title":"Mr. Univ-Prof. Dr. Freiwald, J\u00fcrgen","name":"Freiwald J\u00fcrgen","faculty":2,"luf":"Sportwissenschaft"},{"uid":718,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stefan-freund.html","title":"Mr. Univ-Prof. Dr. Freund, Stefan","name":"Freund Stefan","faculty":1,"luf":"Klassische Philologie"},{"uid":928,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/martin-friesen.html","title":"Mr. Dr. Friesen, Martin","name":"Friesen Martin","faculty":4,"luf":"Mathematik: Analysis und mathematische Systemtheorie"},{"uid":127,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stefanie-frisch.html","title":"Ms. Jun.-Prof. Frisch, Stefanie","name":"Frisch Stefanie","faculty":1,"luf":"Didaktik des Englischen"},{"uid":774,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-fritschen.html","title":"Mr. Fritschen, Michael","name":"Fritschen Michael","faculty":2,"luf":"Integrative Theorie und Praxis des Sports"},{"uid":615,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/klaus-fritzsche.html","title":"Mr. Prof. Dr. Fritzsche, Klaus","name":"Fritzsche Klaus","faculty":4,"luf":"Scientific Computing \/ Software Engineering"},{"uid":555,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/patrik-froehlich-1.html","title":"Mr. Fr\u00f6hlich, Patrik","name":"Fr\u00f6hlich Patrik","faculty":3,"luf":"Personalpsychologie"},{"uid":738,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/judith-frohn.html","title":"Ms. Univ-Prof. Dr. Frohn, Judith","name":"Frohn Judith","faculty":2,"luf":0},{"uid":537,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andreas-frommer.html","title":"Mr. Prof. Dr. Frommer, Andreas","name":"Frommer Andreas","faculty":4,"luf":"Angewandte Informatik"},{"uid":497,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christoph-fuhrmann.html","title":"Mr. Dr. Fuhrmann, Christoph","name":"Fuhrmann Christoph","faculty":9,"luf":"Berufsbildungsforschung"},{"uid":888,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/simon-funken-1.html","title":"Mr. Funken, Simon","name":"Funken Simon","faculty":3,"luf":"Finanzwirtschaft und Corporate Governance"},{"uid":381,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/robert-fussik.html","title":"Mr. Fussik, Robert","name":"Fussik Robert","faculty":7,"luf":"Neue Fertigungsverfahren und Werkstoffe"},{"uid":1048,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/alexander-gabriel.html","title":"Mr. Gabriel, Alexander","name":"Gabriel Alexander","faculty":7,"luf":"Sicherheitsforschung"},{"uid":395,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/james-leonardo-garzon-real.html","title":"Mr. Garzon-Real, James Leonardo","name":"Garzon-Real James Leonardo","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":311,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/monika-gatzke.html","title":"Ms. Gatzke, Monika","name":"Gatzke Monika","faculty":6,"luf":"Systemforschung IKT \/ Innovationsstrategien"},{"uid":742,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/hansjuergen-gebhardt.html","title":"Mr. Prof. Dr.-Ing. Gebhardt, Hansj\u00fcrgen","name":"Gebhardt Hansj\u00fcrgen","faculty":7,"luf":"Sicherheitstechnik \/ Arbeitssicherheit"},{"uid":1058,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/uta-gelbke.html","title":"Ms. Dr. Gelbke, Uta","name":"Gelbke Uta","faculty":5,"luf":"Baukonstruktion | Entwurf | Materialkunde"},{"uid":682,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/juergen-gerlach.html","title":"Mr. Univ.-Prof Dr.-Ing. Gerlach, J\u00fcrgen","name":"Gerlach J\u00fcrgen","faculty":5,"luf":"Stra\u00dfenverkehrsplanung und -technik"},{"uid":201,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anita-gerullis.html","title":"Ms. Gerullis, Anita","name":"Gerullis Anita","faculty":9,"luf":"P\u00e4dagogische Diagnostik"},{"uid":796,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ralf-giessler.html","title":"Mr. Dr. Gie\u00dfler, Ralf","name":"Gie\u00dfler Ralf","faculty":1,"luf":"Didaktik des Englischen"},{"uid":1084,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/bela-gipp.html","title":"Mr. Dr.-Ing. habil. Gipp, Bela","name":"Gipp Bela","faculty":6,"luf":"Digitale Medien"},{"uid":573,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anastasiia-gitman.html","title":"Ms. Gitman, Anastasiia","name":"Gitman Anastasiia","faculty":3,"luf":"Betriebswirtschaftslehre, insb. Innovation"},{"uid":215,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/roland-goertz.html","title":"Mr. Univ-Prof. Dr. Goertz, Roland","name":"Goertz Roland","faculty":7,"luf":"Chemische Sicherheit und Abwehrender Brandschutz"},{"uid":678,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/frank-goehmann-1.html","title":"Mr. PD Dr. G\u00f6hmann, Frank","name":"G\u00f6hmann Frank","faculty":4,"luf":"Theoretische Physik"},{"uid":902,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/arndt-goldack.html","title":"Mr. Prof. Dr.-Ing. Goldack, Arndt","name":"Goldack Arndt","faculty":5,"luf":"Baukonstruktion | Entwurf | Materialkunde"},{"uid":990,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/janka-goldan.html","title":"Ms. Goldan, Janka","name":"Goldan Janka","faculty":9,"luf":"Bildungs\u00f6konomik"},{"uid":1130,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/paul-goepfert.html","title":"Mr. Dr. G\u00f6pfert, Paul","name":"G\u00f6pfert Paul","faculty":3,"luf":"Wirtschaftsinforamtik und Operations Research"},{"uid":591,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/patrick-goerrn.html","title":"Mr. Univ.-Prof Dr.-Ing. G\u00f6rrn, Patrick","name":"G\u00f6rrn Patrick","faculty":6,"luf":"Opto- und Nanoelektronik"},{"uid":237,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/hanno-gottschalk.html","title":"Mr. Prof. Dr. Gottschalk, Hanno","name":"Gottschalk Hanno","faculty":4,"luf":"Angewandte Mathematik"},{"uid":505,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/cornelia-graesel.html","title":"Ms. Univ-Prof. Dr. Gr\u00e4sel, Cornelia","name":"Gr\u00e4sel Cornelia","faculty":9,"luf":"Lehr-, Lern- und Unterrichsforschung"},{"uid":593,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/johannes-grebe-ellis.html","title":"Mr. Univ-Prof. Dr. Grebe-Ellis, Johannes","name":"Grebe-Ellis Johannes","faculty":4,"luf":"Physik und ihre Didaktik"},{"uid":730,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/matthias-greiling-1.html","title":"Mr. Greiling, Matthias","name":"Greiling Matthias","faculty":30,"luf":"WWW"},{"uid":351,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-grosche.html","title":"Mr. Univ-Prof. Dr. Grosche, Michael","name":"Grosche Michael","faculty":9,"luf":"Sonderp\u00e4dagogik"},{"uid":696,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ewald-grothe.html","title":"Mr. Prof. Dr. Grothe, Ewald","name":"Grothe Ewald","faculty":1,"luf":"Historisches Seminar"},{"uid":850,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/silke-grothues.html","title":"Ms. Dr. Grothues, Silke","name":"Grothues Silke","faculty":1,"luf":"Germanistik"},{"uid":872,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/steffi-grundmann.html","title":"Ms. Grundmann, Steffi","name":"Grundmann Steffi","faculty":1,"luf":"Alte Geschichte"},{"uid":77,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marc-gruenhagen.html","title":"Mr. Dr. Gr\u00fcnhagen, Marc","name":"Gr\u00fcnhagen Marc","faculty":3,"luf":"Unternehmensgr\u00fcndung und Wirtschaftsentwicklung"},{"uid":932,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/wolfgang-gruenstaeudl.html","title":"Mr. Dr. Gr\u00fcnst\u00e4udl, Wolfgang","name":"Gr\u00fcnst\u00e4udl Wolfgang","faculty":1,"luf":"Bibelwissenschaften"},{"uid":369,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/linda-guenther.html","title":"Ms. Dr. G\u00fcnther, Linda","name":"G\u00fcnther Linda","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":335,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-guenther.html","title":"Mr. Univ-Prof. Dr. G\u00fcnther, Michael","name":"G\u00fcnther Michael","faculty":4,"luf":"Angewandte Mathematik"},{"uid":149,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tristan-gusek.html","title":"Mr. Gusek, Tristan","name":"Gusek Tristan","faculty":7,"luf":"Sicherheitstechnik \/ Arbeitssicherheit"},{"uid":383,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/peter-gust.html","title":"Mr. Univ.-Prof Dr.-Ing. Gust, Peter","name":"Gust Peter","faculty":7,"luf":"Konstruktion (Engineering Design)"},{"uid":930,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/alexander-haack.html","title":"Mr. Haack, Alexander","name":"Haack Alexander","faculty":4,"luf":"Physikalische Chemie"},{"uid":1060,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sascha-hanel.html","title":"Mr. Hanel, Sascha","name":"Hanel Sascha","faculty":9,"luf":"Berufsbildungsforschung"},{"uid":427,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/torsten-harenberg.html","title":"Mr. Dr. Harenberg, Torsten","name":"Harenberg Torsten","faculty":4,"luf":"Chemie"},{"uid":349,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sebastian-harnisch.html","title":"Mr. Harnisch, Sebastian","name":"Harnisch Sebastian","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":163,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/hans-martin-hasselhorn.html","title":"Mr. Prof. Dr. Hasselhorn, Hans Martin","name":"Hasselhorn Hans Martin","faculty":7,"luf":"Arbeitswissenschaft \/ Arbeitsmedizin"},{"uid":848,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-haessler.html","title":"Mr. Univ.-Prof Dr.-Ing. H\u00e4\u00dfler, Michael","name":"H\u00e4\u00dfler Michael","faculty":5,"luf":"Bahnsystemtechnik"},{"uid":1040,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michaela-heer-1.html","title":"Ms. Dr. Heer, Michaela","name":"Heer Michaela","faculty":9,"luf":"Lehr-, Lern- und Unterrichsforschung"},{"uid":866,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/astrid-heidemann.html","title":"Ms. Dr. Heidemann, Astrid","name":"Heidemann Astrid","faculty":1,"luf":"Systematische Theologie"},{"uid":471,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ralf-heiderhoff.html","title":"Mr. Dr.-Ing. Heiderhoff, Ralf","name":"Heiderhoff Ralf","faculty":6,"luf":"Elektronik"},{"uid":746,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/margareta-heilmann.html","title":"Ms. Prof. Dr. Heilmann, Margareta","name":"Heilmann Margareta","faculty":4,"luf":"Angewandte Mathematik"},{"uid":67,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ulrich-heinen.html","title":"Mr. Univ-Prof. Dr. Heinen, Ulrich","name":"Heinen Ulrich","faculty":8,"luf":"Gestaltungstechnik und Kunstgeschichte"},{"uid":1090,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marius-heinrichsmeyer.html","title":"Mr. Heinrichsmeyer, Marius","name":"Heinrichsmeyer Marius","faculty":7,"luf":"Produktsicherheit und Qualit\u00e4tswesen"},{"uid":157,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/thomas-heinze.html","title":"Mr. Univ-Prof. Dr. Heinze, Thomas","name":"Heinze Thomas","faculty":2,"luf":"Organisations- und Wissenschaftssoziologie"},{"uid":517,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/markus-held-1.html","title":"Mr. Univ.-Prof Dr.-Ing. Held, Markus","name":"Held Markus","faculty":5,"luf":"Massivbau"},{"uid":840,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/mark-helle.html","title":"Mr. Helle, Mark","name":"Helle Mark","faculty":7,"luf":"Sicherheitsforschung"},{"uid":241,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/vivien-heller.html","title":"Ms. Prof. Dr. Heller, Vivien","name":"Heller Vivien","faculty":1,"luf":"Spracherwerb und -sozialisation, linguistische Unterrichtsforschung, Sprachdidaktik"},{"uid":411,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/manfred-helmus.html","title":"Mr. Univ.-Prof Dr.-Ing. Helmus, Manfred","name":"Helmus Manfred","faculty":5,"luf":"Baubetrieb und Bauwirtschaft"},{"uid":273,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/fabian-hemmert.html","title":"Mr. Univ.-Prof Dr.-Ing. Hemmert, Fabian","name":"Hemmert Fabian","faculty":8,"luf":"Interface- und User Experience-Design"},{"uid":776,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/susanne-hendel-1.html","title":"Ms. Hendel, Susanne","name":"Hendel Susanne","faculty":5,"luf":"Bauphysik und Technische Geb\u00e4udeausr\u00fcstung"},{"uid":543,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/reinhard-hentschke-1.html","title":"Mr. Univ-Prof. Dr. Hentschke, Reinhard","name":"Hentschke Reinhard","faculty":4,"luf":"Theoretical chemical Physics"},{"uid":1082,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jessica-hermanns.html","title":"Ms. Hermanns, Jessica","name":"Hermanns Jessica","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":712,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marie-luca-herzig.html","title":"Ms. Herzig, Marie-Luca","name":"Herzig Marie-Luca","faculty":2,"luf":"Sportmedizin"},{"uid":708,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/thomas-hilberg.html","title":"Mr. Univ-Prof. Dr. Hilberg, Thomas","name":"Hilberg Thomas","faculty":2,"luf":"Sportmedizin"},{"uid":525,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/annette-hillebrandt.html","title":"Ms. Prof. Dipl.-Ing. Hillebrandt, Annette","name":"Hillebrandt Annette","faculty":5,"luf":"Baukonstruktion | Entwurf | Materialkunde"},{"uid":115,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jens-hiller.html","title":"Mr. Dr. Hiller, Jens","name":"Hiller Jens","faculty":2,"luf":"Internationale Beziehungen \/ Friedens- und Konfliktforschung"},{"uid":1172,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/dominic-hirschbuehl.html","title":"Mr. Dr. Hirschb\u00fchl, Dominic","name":"Hirschb\u00fchl Dominic","faculty":4,"luf":"Chemie"},{"uid":589,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/alexander-hobert-1.html","title":"Mr. Hobert, Alexander","name":"Hobert Alexander","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":417,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/holger-hoffmann.html","title":"Mr. Prof. Dipl.-Ing. Hoffmann, Holger","name":"Hoffmann Holger","faculty":5,"luf":"Darstellungsmethodik und Entwerfen"},{"uid":878,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/bettina-hofmann.html","title":"Ms. Dr. Hofmann, Bettina","name":"Hofmann Bettina","faculty":1,"luf":"Amerikanistik"},{"uid":1026,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/markus-hofmann-1.html","title":"Mr. Dr. Hofmann, Markus","name":"Hofmann Markus","faculty":2,"luf":"Kognitive Neurowissenschaft"},{"uid":880,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/markus-hofmann.html","title":"Mr. Dr. Hofmann, Markus","name":"Hofmann Markus","faculty":2,"luf":"Psychologie"},{"uid":814,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ruediger-hofmann.html","title":"Mr. Dr.-Ing. Hofmann, R\u00fcdiger","name":"Hofmann R\u00fcdiger","faculty":2,"luf":"Sportwissenschaft"},{"uid":2,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/werner-hofschuster.html","title":"Mr. Dr. Hofschuster, Werner","name":"Hofschuster Werner","faculty":4,"luf":"Scientific Computing \/ Software Engineering"},{"uid":808,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christian-hoelbling.html","title":"Mr. PD Dr. H\u00f6lbling, Christian","name":"H\u00f6lbling Christian","faculty":4,"luf":"Theoretische Physik"},{"uid":728,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/roman-hoellwieser.html","title":"Mr. Dr. H\u00f6llwieser, Roman","name":"H\u00f6llwieser Roman","faculty":4,"luf":"Theoretische Physik"},{"uid":802,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tim-holthaus.html","title":"Mr. Holthaus, Tim","name":"Holthaus Tim","faculty":5,"luf":"G\u00fcterverkehrsplanung und Transportlogistik"},{"uid":331,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/nikolai-hopfer.html","title":"Mr. Hopfer, Nikolai","name":"Hopfer Nikolai","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":648,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jens-hornbostel.html","title":"Mr. Prof. Dr. Hornbostel, Jens","name":"Hornbostel Jens","faculty":4,"luf":"Topologie"},{"uid":75,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/felix-huber.html","title":"Mr. Univ.-Prof Dr.-Ing. Huber, Felix","name":"Huber Felix","faculty":5,"luf":"Umweltvertr\u00e4gliche Infrastrukturplanung, Stadtbauwesen"},{"uid":670,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/roland-huber-2.html","title":"Mr. Univ-Prof. Dr. Huber, Roland","name":"Huber Roland","faculty":4,"luf":"Algebra"},{"uid":567,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/horst-huebner-2.html","title":"Mr. PD Dr. H\u00fcbner, Horst","name":"H\u00fcbner Horst","faculty":2,"luf":"Sportwissenschaft"},{"uid":976,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sebastian-huembert-schnurr.html","title":"Mr. Dr. H\u00fcmbert-Schnurr, Sebastian","name":"H\u00fcmbert-Schnurr Sebastian","faculty":4,"luf":"Physik und ihre Didaktik"},{"uid":65,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/peter-imbusch.html","title":"Mr. Prof. Dr. Imbusch, Peter","name":"Imbusch Peter","faculty":2,"luf":"Politische Soziologie"},{"uid":377,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/birgit-jacob.html","title":"Ms. Univ-Prof. Dr. Jacob, Birgit","name":"Jacob Birgit","faculty":4,"luf":"Mathematik: Analysis und mathematische Systemtheorie"},{"uid":1192,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ralf-jahn-1.html","title":"Mr. Jahn, Ralf","name":"Jahn Ralf","faculty":7,"luf":"Sicherheitsforschung"},{"uid":1160,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christian-jaenig.html","title":"Mr. J\u00e4nig, Christian","name":"J\u00e4nig Christian","faculty":1,"luf":"Neues Testament, Geschichte der Alten Kirche"},{"uid":207,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/uwe-janoske.html","title":"Mr. Univ.-Prof Dr.-Ing. habil. Janoske, Uwe","name":"Janoske Uwe","faculty":7,"luf":"Str\u00f6mungs- und Thermodynamik"},{"uid":91,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/leoni-janssen.html","title":"Ms. Janssen, Leoni","name":"Janssen Leoni","faculty":9,"luf":"Latinistik"},{"uid":754,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jens-jaeschke.html","title":"Mr. J\u00e4schke, Jens","name":"J\u00e4schke Jens","faculty":4,"luf":"Angewandte Mathematik"},{"uid":433,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/per-jensen.html","title":"Mr. Dr. Jensen, Per","name":"Jensen Per","faculty":4,"luf":"Theoretical Molecular Spectroscopy"},{"uid":345,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christopher-johae.html","title":"Mr. Johae, Christopher","name":"Johae Christopher","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":225,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jochen-johrendt.html","title":"Mr. Univ-Prof. Dr. Johrendt, Jochen","name":"Johrendt Jochen","faculty":1,"luf":"Mittelalterliche Geschichte"},{"uid":766,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/peter-jonk-2.html","title":"Mr. Dr. Jonk, Peter","name":"Jonk Peter","faculty":30,"luf":"UNISERVICE TRANSFER"},{"uid":547,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ulrich-jung.html","title":"Mr. Univ.-Prof Dr.-Ing. Jung, Ulrich","name":"Jung Ulrich","faculty":6,"luf":"Digital- und Offsetdruck \/Industrieller Druck \/Funtionales Drucken"},{"uid":513,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/hendrik-juerges-1.html","title":"Mr. Prof. Dr. J\u00fcrges, Hendrik","name":"J\u00fcrges Hendrik","faculty":3,"luf":"Gesundheits\u00f6konomie"},{"uid":658,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/falko-juessen.html","title":"Mr. Prof. Dr. J\u00fc\u00dfen, Falko","name":"J\u00fc\u00dfen Falko","faculty":3,"luf":"Makro\u00f6konomik"},{"uid":4,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anke-kahl.html","title":"Ms. Univ.-Prof Dr.-Ing. habil. Kahl, Anke","name":"Kahl Anke","faculty":7,"luf":"Sicherheitstechnik \/ Arbeitssicherheit"},{"uid":1022,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christoph-kalicinsky.html","title":"Mr. Dr. Kalicinsky, Christoph","name":"Kalicinsky Christoph","faculty":4,"luf":"Atmosph\u00e4renphysik"},{"uid":49,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andreas-kalweit.html","title":"Mr. Univ.-Prof. Kalweit, Andreas","name":"Kalweit Andreas","faculty":8,"luf":"Manufacturing and Material Science, Schwerpunkt Konstruktionstechnik und -systematik im Design"},{"uid":698,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/karl-heinz-kampert.html","title":"Mr. Univ-Prof. Dr. Kampert, Karl-Heinz","name":"Kampert Karl-Heinz","faculty":4,"luf":"Wasserwirtschaft und Wasserbau"},{"uid":317,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kristof-kamps.html","title":"Mr. Dr. Kamps, Kristof","name":"Kamps Kristof","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":535,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/matthias-kaufhold.html","title":"Mr. Kaufhold, Matthias","name":"Kaufhold Matthias","faculty":5,"luf":"Baubetrieb und Bauwirtschaft"},{"uid":820,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/oliver-kautny.html","title":"Mr. Dr. Kautny, Oliver","name":"Kautny Oliver","faculty":1,"luf":"Musikwissenschaft"},{"uid":1108,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/helmke-jan-keden-1.html","title":"Mr. Univ-Prof. Dr. Keden, Helmke Jan","name":"Keden Helmke Jan","faculty":1,"luf":"Musikwissenschaft \/ Musikp\u00e4dagogik"},{"uid":978,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/alain-michel-keller.html","title":"Mr. Keller, Alain Michel","name":"Keller Alain Michel","faculty":30,"luf":"E-Learning"},{"uid":984,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/hans-m-keller.html","title":"Mr. Keller, Hans M.","name":"Keller Hans M.","faculty":6,"luf":"Bildgebende Systeme"},{"uid":175,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/birte-kellermeier-rehbein.html","title":"Ms. Dr. Kellermeier-Rehbein, Birte","name":"Kellermeier-Rehbein Birte","faculty":1,"luf":"Germanistische Sprachwissenschaft"},{"uid":882,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/svenja-kemper.html","title":"Ms. Dr.-Ing. Kemper, Svenja","name":"Kemper Svenja","faculty":5,"luf":"Wasserwirtschaft und Wasserbau"},{"uid":519,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ragna-kepplin.html","title":"Ms. Kepplin, Ragna","name":"Kepplin Ragna","faculty":5,"luf":"Massivbau"},{"uid":389,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sandra-kernebeck.html","title":"Ms. Kernebeck, Sandra","name":"Kernebeck Sandra","faculty":7,"luf":"Neue Fertigungsverfahren und Werkstoffe"},{"uid":83,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/hendrik-kersten.html","title":"Mr. Dr. Kersten, Hendrik","name":"Kersten Hendrik","faculty":4,"luf":"physical chemistry, mass spectrometry and plasmas"},{"uid":1092,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/fabian-kessl.html","title":"Mr. Prof. Dr. Kessl, Fabian","name":"Kessl Fabian","faculty":2,"luf":"Bildungsforschung in Sambia"},{"uid":473,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/holger-kesting.html","title":"Mr. Kesting, Holger","name":"Kesting Holger","faculty":5,"luf":"Baubetrieb und Bauwirtschaft"},{"uid":964,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/basma-khelfa.html","title":"Ms. Khelfa, Basma","name":"Khelfa Basma","faculty":7,"luf":0},{"uid":321,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/mehmet-sefa-kilicsoy.html","title":"Mr. Dr. Kilicsoy, Mehmet Sefa","name":"Kilicsoy Mehmet Sefa","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":844,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/noelle-kinalzik.html","title":"Ms. Kinalzik, Noelle","name":"Kinalzik Noelle","faculty":1,"luf":"Spracherwerb und -sozialisation, linguistische Unterrichtsforschung, Sprachdidaktik"},{"uid":339,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/martin-king.html","title":"Mr. Dr. King, Martin","name":"King Martin","faculty":4,"luf":"Philosophie der Physik"},{"uid":727,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stefan-kirsch.html","title":"Mr. Prof. Dr. Kirsch, Stefan","name":"Kirsch Stefan","faculty":4,"luf":"Organische Chemie"},{"uid":463,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/albert-kisslinger.html","title":"Mr. Ki\u00dflinger, Albert","name":"Ki\u00dflinger Albert","faculty":7,"luf":"Methoden der Sicherheitstechnik \/ Unfallforschung"},{"uid":125,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kathrin-klamroth.html","title":"Ms. Prof. Dr. Klamroth, Kathrin","name":"Klamroth Kathrin","faculty":4,"luf":"Angewandte Mathematik"},{"uid":1020,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jonas-klaes.html","title":"Mr. Kl\u00e4s, Jonas","name":"Kl\u00e4s Jonas","faculty":4,"luf":"Festk\u00f6rperphysik"},{"uid":686,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/joerg-kleffmann.html","title":"Mr. PD Dr. Kleffmann, J\u00f6rg","name":"Kleffmann J\u00f6rg","faculty":4,"luf":"Physikalische Chemie"},{"uid":447,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christian-klein.html","title":"Mr. Dr. Klein, Christian","name":"Klein Christian","faculty":1,"luf":"Germanistik"},{"uid":173,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/torsten-kleine.html","title":"Mr. Kleine, Torsten","name":"Kleine Torsten","faculty":2,"luf":"Integrative Theorie und Praxis des Sports"},{"uid":437,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jeanette-klemmer.html","title":"Ms. Dr. Klemmer, Jeanette","name":"Klemmer Jeanette","faculty":5,"luf":"G\u00fcterverkehrsplanung und Transportlogistik"},{"uid":459,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/thomas-klemmer.html","title":"Mr. Klemmer, Thomas","name":"Klemmer Thomas","faculty":5,"luf":"G\u00fcterverkehrsplanung und Transportlogistik"},{"uid":1102,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sebastian-kluckert.html","title":"Mr. Univ-Prof. Dr. Kluckert, Sebastian","name":"Kluckert Sebastian","faculty":3,"luf":"\u00d6ffentliches Recht"},{"uid":387,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andreas-kluemper.html","title":"Mr. Univ-Prof. Dr. Kl\u00fcmper, Andreas","name":"Kl\u00fcmper Andreas","faculty":4,"luf":"Theoretische Physik"},{"uid":461,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/brian-klusmann.html","title":"Ms. Klusmann, Brian","name":"Klusmann Brian","faculty":5,"luf":"Baubetrieb und Bauwirtschaft"},{"uid":557,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andre-klussmann.html","title":"Mr. Jun.-Prof. Dr.-Ing. Klu\u00dfmann, Andr\u00e9","name":"Klu\u00dfmann Andr\u00e9","faculty":7,"luf":"Human Engineering"},{"uid":952,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/simon-knappe.html","title":"Mr. Knappe, Simon","name":"Knappe Simon","faculty":5,"luf":"Stra\u00dfenverkehrsplanung und -technik"},{"uid":145,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-knappstein.html","title":"Mr. Knappstein, Michael","name":"Knappstein Michael","faculty":3,"luf":"Personalmanagement"},{"uid":660,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/francesco-knechtli.html","title":"Mr. Prof. Dr. Knechtli, Francesco","name":"Knechtli Francesco","faculty":4,"luf":"Theoretische Elementarteilchenphysik"},{"uid":994,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/helge-knuppertz.html","title":"Mr. Dr. Knuppertz, Helge","name":"Knuppertz Helge","faculty":2,"luf":"Psychologie"},{"uid":269,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/juliane-koeberlein-neu.html","title":"Ms. Jun.-Prof. K\u00f6berlein-Neu, Juliane","name":"K\u00f6berlein-Neu Juliane","faculty":3,"luf":"Gesundheits\u00f6konomie"},{"uid":303,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ursula-kocher.html","title":"Ms. Prof. Dr. Kocher, Ursula","name":"Kocher Ursula","faculty":1,"luf":"Allgemeine und Vergleichende Literaturwissenschaft"},{"uid":800,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/benjamin-koenning.html","title":"Mr. K\u00f6nning, Benjamin","name":"K\u00f6nning Benjamin","faculty":1,"luf":"Germanistik \/ Didaktik der deutschen Sprache und Literatur \/ Schwerpunkt: Sprachdidaktik"},{"uid":329,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ralf-koppmann.html","title":"Mr. Prof. Dr. Koppmann, Ralf","name":"Koppmann Ralf","faculty":4,"luf":"Atmosph\u00e4renphysik"},{"uid":768,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marlon-koralewicz.html","title":"Mr. Koralewicz, Marlon","name":"Koralewicz Marlon","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":385,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tobias-kornrumpf.html","title":"Mr. Kornrumpf, Tobias","name":"Kornrumpf Tobias","faculty":6,"luf":"Regenerative Energiesysteme"},{"uid":1178,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tomasz-korzec.html","title":"Mr. Dr. Korzec, Tomasz","name":"Korzec Tomasz","faculty":4,"luf":"Theoretische Physik"},{"uid":119,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/dennis-koethemann.html","title":"Mr. Dr. K\u00f6themann, Dennis","name":"K\u00f6themann Dennis","faculty":2,"luf":"Quantitative Methoden der empirischen Sozialforschung und Sozialstrukturanalyse"},{"uid":762,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kevin-kotthaus.html","title":"Mr. Kotthaus, Kevin","name":"Kotthaus Kevin","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":916,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/mireille-kozhaya.html","title":"Ms. Kozhaya, Mireille","name":"Kozhaya Mireille","faculty":3,"luf":"Bildungs\u00f6konomik"},{"uid":487,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/philipp-kraemer-1.html","title":"Mr. Dr. Kr\u00e4mer, Philipp","name":"Kr\u00e4mer Philipp","faculty":9,"luf":"Sonderp\u00e4dagogische Psychologie"},{"uid":307,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-krause.html","title":"Mr. Dr. Krause, Michael","name":"Krause Michael","faculty":6,"luf":"Medien\u00f6konomie \/ Innovationsmamagement"},{"uid":824,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jochen-krautz.html","title":"Mr. Univ-Prof. Dr. Krautz, Jochen","name":"Krautz Jochen","faculty":8,"luf":"Kunstp\u00e4dagogik"},{"uid":457,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sophia-victoria-krebs.html","title":"Ms. Krebs, Sophia Victoria","name":"Krebs Sophia Victoria","faculty":1,"luf":"Editionswissenschaft"},{"uid":650,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marc-krebsbach.html","title":"Mr. Dr. Krebsbach, Marc","name":"Krebsbach Marc","faculty":4,"luf":"Atmosph\u00e4renphysik"},{"uid":710,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/steffen-krueger.html","title":"Mr. Kr\u00fcger, Steffen","name":"Kr\u00fcger Steffen","faculty":2,"luf":"Sportmedizin"},{"uid":1098,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/miriam-kuckuck.html","title":"Ms. Jun.-Prof. Dr. Kuckuck, Miriam","name":"Kuckuck Miriam","faculty":2,"luf":"Didaktik des Sachunterrichts"},{"uid":425,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/wolfang-kuehn.html","title":"Mr. Univ.-Prof Dr.-Ing. habil. K\u00fchn, Wolfang","name":"K\u00fchn Wolfang","faculty":6,"luf":"Internet der Dinge"},{"uid":798,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/wolfgang-kuhn.html","title":"Mr. Kuhn, Wolfgang","name":"Kuhn Wolfgang","faculty":3,"luf":"Unternehmensgr\u00fcndung und Wirtschaftsentwicklung"},{"uid":55,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anton-kummert.html","title":"Mr. Prof. Dr.-Ing. Kummert, Anton","name":"Kummert Anton","faculty":6,"luf":"Theoretische Nachrichtentechnik, Signalverarbeitung"},{"uid":1024,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/elena-kunadt.html","title":"Ms. Kunadt, Elena","name":"Kunadt Elena","faculty":1,"luf":"Wissenschaftsgeschichte"},{"uid":934,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jacqueline-kunhenn.html","title":"Ms. Kunhenn, Jacqueline","name":"Kunhenn Jacqueline","faculty":2,"luf":"Bildungsforschung in Sambia"},{"uid":1032,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anne-kurth-2.html","title":"Ms. kurth, anne","name":"kurth anne","faculty":8,"luf":"Strategic Design"},{"uid":1018,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/friederike-kuster.html","title":"Ms. Prof. Dr. Kuster, Friederike","name":"Kuster Friederike","faculty":1,"luf":"Praktische Philosophie"},{"uid":477,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/bruno-lang.html","title":"Mr. Prof. Dr. Lang, Bruno","name":"Lang Bruno","faculty":4,"luf":"Angewandte Informatik - Algorithmik"},{"uid":1000,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/frederik-lauber.html","title":"Mr. Lauber, Frederik","name":"Lauber Frederik","faculty":4,"luf":"Astrophysik"},{"uid":415,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/bert-leerkamp.html","title":"Mr. Univ.-Prof Dr.-Ing. Leerkamp, Bert","name":"Leerkamp Bert","faculty":5,"luf":"G\u00fcterverkehrsplanung und Transportlogistik"},{"uid":1056,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/niklaus-lehmann.html","title":"Mr. Lehmann, Niklaus","name":"Lehmann Niklaus","faculty":4,"luf":"Chemie"},{"uid":974,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sabine-lerch.html","title":"Ms. Lerch, Sabine","name":"Lerch Sabine","faculty":6,"luf":"Regelungstechnik"},{"uid":954,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jonas-leschke.html","title":"Mr. Leschke, Jonas","name":"Leschke Jonas","faculty":7,"luf":"Didaktik der Technik"},{"uid":1164,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/peer-leske.html","title":"Ms. Leske, Peer","name":"Leske Peer","faculty":9,"luf":"Didaktik der Technik"},{"uid":756,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/daniel-lichte.html","title":"Mr. Dr.-Ing. Lichte, Daniel","name":"Lichte Daniel","faculty":7,"luf":"Risikoanalyse"},{"uid":495,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/friedrich-linderkamp-1.html","title":"Mr. Univ-Prof. Dr. Linderkamp, Friedrich","name":"Linderkamp Friedrich","faculty":9,"luf":"Sonderp\u00e4dagogische Psychologie"},{"uid":720,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/gertrud-lohaus.html","title":"Ms. Univ-Prof. Dr. Lohaus, Gertrud","name":"Lohaus Gertrud","faculty":4,"luf":"Molekulare Pflanzenforschung\/Pflanzenbiochemie (Botanik)"},{"uid":922,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/simon-lohmann.html","title":"Mr. Lohmann, Simon","name":"Lohmann Simon","faculty":6,"luf":"Automatisierungstechnik \/ Informatik"},{"uid":245,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/horst-lohnstein.html","title":"Mr. Univ-Prof. Dr. Lohnstein, Horst","name":"Lohnstein Horst","faculty":1,"luf":"Germanistische Sprachwissenschaft"},{"uid":780,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andreas-lotter.html","title":"Mr. Lotter, Andreas","name":"Lotter Andreas","faculty":7,"luf":"Sicherheitsforschung"},{"uid":656,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christhard-lueck.html","title":"Mr. Univ-Prof. Dr. L\u00fcck, Christhard","name":"L\u00fcck Christhard","faculty":1,"luf":"Religionsp\u00e4dagogik und Didaktik der Ev. Religionslehre"},{"uid":491,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/soeren-luedeke.html","title":"Mr. L\u00fcdeke, S\u00f6ren","name":"L\u00fcdeke S\u00f6ren","faculty":9,"luf":"Sonderp\u00e4dagogische Psychologie"},{"uid":323,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marcel-ludwig.html","title":"Mr. Dr. Ludwig, Marcel","name":"Ludwig Marcel","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":674,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tim-lukas-1.html","title":"Mr. Dr. Lukas, Tim","name":"Lukas Tim","faculty":7,"luf":"Methoden der Sicherheitstechnik \/ Unfallforschung"},{"uid":1156,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/wolfgang-lukas.html","title":"Mr. Prof. Dr. Lukas, Wolfgang","name":"Lukas Wolfgang","faculty":1,"luf":"Editionswissenschaft"},{"uid":740,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/timo-lueke-2.html","title":"Mr. L\u00fcke, Timo","name":"L\u00fcke Timo","faculty":9,"luf":"Sonderp\u00e4dagogik"},{"uid":680,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/claudia-machold.html","title":"Ms. Prof. Dr. Machold, Claudia","name":"Machold Claudia","faculty":2,"luf":"3D-Druck & Additive Fertigung"},{"uid":910,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anna-makles.html","title":"Ms. Dr. Makles, Anna","name":"Makles Anna","faculty":3,"luf":"Bildungs\u00f6konomik"},{"uid":714,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/matias-martinez-1.html","title":"Mr. Prof. Dr. Mart\u00ednez, Mat\u00edas","name":"Mart\u00ednez Mat\u00edas","faculty":1,"luf":"Germanistik"},{"uid":1142,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andrea-mayer-1.html","title":"Ms. Mayer, Andrea","name":"Mayer Andrea","faculty":5,"luf":"Wasserwirtschaft und Wasserbau"},{"uid":982,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anica-meins-becker.html","title":"Ms. Dr.-Ing. Meins-Becker, Anica","name":"Meins-Becker Anica","faculty":5,"luf":"Baubetrieb und Bauwirtschaft"},{"uid":1070,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tobias-meisen-1.html","title":"Mr. Prof. Dr.-Ing. Meisen, Tobias","name":"Meisen Tobias","faculty":6,"luf":"Technologien\/Management der Digitalen Transformation"},{"uid":147,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/astrid-messerschmidt.html","title":"Ms. Prof. Dr. Messerschmidt, Astrid","name":"Messerschmidt Astrid","faculty":2,"luf":"Erziehungswissenschaft mit dem Schwerpunkt Geschlecht und Diversit\u00e4t"},{"uid":946,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/loriana-metzger.html","title":"Ms. Metzger, Loriana","name":"Metzger Loriana","faculty":2,"luf":"Erziehungswissenschaft mit dem Schwerpunkt Berufs- und Weiterbildung"},{"uid":884,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anne-rose-meyer-eisenhut.html","title":"Ms. PD Dr. Meyer-Eisenhut, Anne-Rose","name":"Meyer-Eisenhut Anne-Rose","faculty":1,"luf":"Germanistik"},{"uid":333,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/david-michalik.html","title":"Mr. Michalik, David","name":"Michalik David","faculty":6,"luf":"\u00d6ffentliche Verkehrssysteme und Mobilit\u00e4tsmanagement"},{"uid":996,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/volker-mittendorf.html","title":"Mr. Dr. Mittendorf, Volker","name":"Mittendorf Volker","faculty":2,"luf":"Politisches System der Bundesrepublik"},{"uid":197,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/fabian-moehrke.html","title":"Mr. Dr. M\u00f6hrke, Fabian","name":"M\u00f6hrke Fabian","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":1076,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/helga-moelleken-1.html","title":"Ms. Dr. M\u00f6lleken, Helga","name":"M\u00f6lleken Helga","faculty":4,"luf":"Management chemischer Prozesse in der Industrie"},{"uid":63,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/gabriele-molzberger.html","title":"Ms. Univ-Prof. Dr. Molzberger, Gabriele","name":"Molzberger Gabriele","faculty":2,"luf":"Erziehungswissenschaft mit dem Schwerpunkt Berufs- und Weiterbildung"},{"uid":521,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/rainer-mucha.html","title":"Mr. Mucha, Rainer","name":"Mucha Rainer","faculty":5,"luf":"Massivbau"},{"uid":970,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/waltraud-mudrich.html","title":"Ms. Mudrich, Waltraud","name":"Mudrich Waltraud","faculty":1,"luf":"Musikwissenschaft \/ Musikp\u00e4dagogik"},{"uid":988,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ann-katrin-mueller.html","title":"Ms. M\u00fcller, Ann-Katrin","name":"M\u00fcller Ann-Katrin","faculty":5,"luf":"\u00d6konomie des Planens und Bauens"},{"uid":1072,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/juergen-mueller.html","title":"Mr. PD Dr. M\u00fcller, J\u00fcrgen","name":"M\u00fcller J\u00fcrgen","faculty":4,"luf":"Algebra"},{"uid":736,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/natascha-mueller.html","title":"Ms. Univ-Prof. Dr. M\u00fcller, Natascha","name":"M\u00fcller Natascha","faculty":1,"luf":"Romanische Sprachwissenschaft, Mehrsprachigkeitsforschung"},{"uid":1104,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/bernd-naujoks.html","title":"Mr. Prof. Dr.-Ing. Naujoks, Bernd","name":"Naujoks Bernd","faculty":5,"luf":"Lehrstuhl f\u00fcr Stahl- und Verbundkonstruktionen"},{"uid":1088,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/annemarie-neser.html","title":"Ms. Prof. Dr.-Ing. Neser, AnneMarie","name":"Neser AnneMarie","faculty":8,"luf":"Baukultur und Raumgestaltung"},{"uid":950,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/claudia-neugebauer.html","title":"Ms. Prof. Dr. Neugebauer, Claudia","name":"Neugebauer Claudia","faculty":3,"luf":"Betriebswirtschaftliche Steuerlehre"},{"uid":864,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stefan-neumann-4.html","title":"Mr. Dr. Neumann, Stefan","name":"Neumann Stefan","faculty":1,"luf":"Literatur- und Medienwissenschaft"},{"uid":1118,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anne-neuser.html","title":"Ms. Neuser, Anne","name":"Neuser Anne","faculty":2,"luf":"Geographie"},{"uid":700,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/irmgard-nickel-bacon.html","title":"Ms. Univ-Prof. Dr. Nickel-Bacon, Irmgard","name":"Nickel-Bacon Irmgard","faculty":1,"luf":"Didaktik der deutschen Sprache und Literatur \/ Schwerpunkt Literaturdidaktik"},{"uid":1148,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stephan-nowotnick.html","title":"Mr. Dr. Nowotnick , Stephan","name":"Nowotnick Stephan","faculty":1,"luf":"Romanistische Literaturwissenschaft"},{"uid":784,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kathrin-nuehlen-1.html","title":"Ms. N\u00fchlen, Kathrin","name":"N\u00fchlen Kathrin","faculty":1,"luf":"Editionswissenschaft"},{"uid":636,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/dominik-orth.html","title":"Mr. Dr. Orth, Dominik","name":"Orth Dominik","faculty":1,"luf":"Literatur- und Medienwissenschaft"},{"uid":900,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/yahya-oez.html","title":"Mr. Dr. \u00d6z, Yahya","name":"\u00d6z Yahya","faculty":4,"luf":"Theoretische Physik"},{"uid":968,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/katrin-parino-1.html","title":"Ms. Parino, Katrin","name":"Parino Katrin","faculty":1,"luf":"Didaktik der deutschen Sprache und Literatur (Sprachdidaktik)"},{"uid":972,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/oliver-passon.html","title":"Mr. Dr. Passon, Oliver","name":"Passon Oliver","faculty":4,"luf":"Physik und ihre Didaktik"},{"uid":371,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/frederik-paulat.html","title":"Mr. Dr. Paulat, Frederik","name":"Paulat Frederik","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":337,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/erik-pawlowski.html","title":"Mr. Dr.-Ing. Pawlowski, Erik","name":"Pawlowski Erik","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":918,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/claudia-pereira-kastens.html","title":"Ms. Jun.-Prof. Dr. Pereira Kastens, Claudia","name":"Pereira Kastens Claudia","faculty":9,"luf":"Bildungsforschung in Sambia"},{"uid":583,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andrea-peters.html","title":"Ms. Peters, Andrea","name":"Peters Andrea","faculty":3,"luf":"Betriebswirtschaftslehre, insb. Innovation"},{"uid":1096,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/katja-pfeiffer.html","title":"Ms. Univ.-Prof. Pfeiffer, Katja","name":"Pfeiffer Katja","faculty":8,"luf":0},{"uid":1186,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/laura-pfeiffer.html","title":"Ms. Pfeiffer, Laura","name":"Pfeiffer Laura","faculty":4,"luf":"Didaktik der Mathematik"},{"uid":948,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/katrin-pietsch.html","title":"Ms. Pietsch, Katrin","name":"Pietsch Katrin","faculty":9,"luf":"Bildungsforschung in Sambia"},{"uid":942,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/uta-pigorsch.html","title":"Ms. Prof. Dr. Pigorsch, Uta","name":"Pigorsch Uta","faculty":3,"luf":"\u00d6konometrie"},{"uid":908,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ronja-pillmann-1.html","title":"Ms. Pillmann, Ronja","name":"Pillmann Ronja","faculty":2,"luf":"Bildungsforschung in Sambia"},{"uid":361,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/maike-pisters.html","title":"Ms. Pisters, Maike","name":"Pisters Maike","faculty":2,"luf":"Methodenlehre und Psychologische Diagnostik"},{"uid":213,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/david-pithan.html","title":"Mr. Pithan, David","name":"Pithan David","faculty":2,"luf":"Organisations- und Wissenschaftssoziologie"},{"uid":1152,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/natascha-pomino.html","title":"Ms. Univ-Prof. Dr. Pomino, Natascha","name":"Pomino Natascha","faculty":1,"luf":"Romanistik - Sprachwissenschaft"},{"uid":1194,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andre-pomp.html","title":"Mr. Pomp, Andr\u00e9","name":"Pomp Andr\u00e9","faculty":6,"luf":"Angewandte Informatik"},{"uid":171,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/uta-poplutz.html","title":"Ms. Univ-Prof. Dr. Poplutz, Uta","name":"Poplutz Uta","faculty":1,"luf":"Matth\u00e4usevangelium"},{"uid":1198,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andre-poweleit.html","title":"Mr. Dr. Poweleit, Andr\u00e9","name":"Poweleit Andr\u00e9","faculty":2,"luf":"Integrative Theorie und Praxis des Sports"},{"uid":481,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/gela-preisfeld-1.html","title":"Ms. Univ-Prof. Dr. Preisfeld, Gela","name":"Preisfeld Gela","faculty":4,"luf":"Chloroplastengenom-Analysen, Intron-Analysen, Ciliaten als biologischer Filter in Kl\u00e4ranlagen, Algen als Symbiosen in Meeresnacktschnecken"},{"uid":489,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/bodo-przibilla.html","title":"Mr. Przibilla, Bodo","name":"Przibilla Bodo","faculty":9,"luf":"Sonderp\u00e4dagogische Psychologie"},{"uid":734,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/matthias-pulsfort-1.html","title":"Mr. Univ.-Prof Dr.-Ing. Pulsfort, Matthias","name":"Pulsfort Matthias","faculty":5,"luf":"Geotechnik"},{"uid":836,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/thomas-pursche-1.html","title":"Mr. Pursche, Thomas","name":"Pursche Thomas","faculty":6,"luf":"Regelungstechnik"},{"uid":938,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/carla-puetz.html","title":"Ms. P\u00fctz, Carla","name":"P\u00fctz Carla","faculty":5,"luf":"Baubetrieb und Bauwirtschaft"},{"uid":1170,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sebastian-rachuba.html","title":"Mr. Jun.-Prof. Dr. Rachuba, Sebastian","name":"Rachuba Sebastian","faculty":3,"luf":"Produktion und Logistik"},{"uid":758,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/lena-raduenz.html","title":"Ms. Rad\u00fcnz, Lena","name":"Rad\u00fcnz Lena","faculty":4,"luf":"Didaktik der Mathematik"},{"uid":57,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sylvia-rahn.html","title":"Ms. Prof. Dr. Rahn, Sylvia","name":"Rahn Sylvia","faculty":9,"luf":"Berufsbildungsforschung"},{"uid":305,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/monika-rathert.html","title":"Ms. Univ-Prof. Dr. Rathert, Monika","name":"Rathert Monika","faculty":1,"luf":"Germanistische Sprachwissenschaft"},{"uid":253,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/volker-remmert.html","title":"Mr. Univ-Prof. Dr. Remmert, Volker","name":"Remmert Volker","faculty":1,"luf":"Wissenschaftsgeschichte"},{"uid":503,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ulrike-reutter.html","title":"Ms. Univ.-Prof Dr.-Ing. Reutter, Ulrike","name":"Reutter Ulrike","faculty":5,"luf":"\u00d6ffentliche Verkehrssysteme und Mobilit\u00e4tsmanagement"},{"uid":527,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/petra-riegler-floors.html","title":"Ms. Riegler-Floors, Petra","name":"Riegler-Floors Petra","faculty":5,"luf":"Baukonstruktion | Entwurf | Materialkunde"},{"uid":894,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anna-rings.html","title":"Ms. Rings, Anna","name":"Rings Anna","faculty":7,"luf":"Arbeitswissenschaft \/ Arbeitsmedizin"},{"uid":261,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/joerg-rinklebe.html","title":"Mr. Univ.-Prof Dr.-Ing. Rinklebe, J\u00f6rg","name":"Rinklebe J\u00f6rg","faculty":5,"luf":"Boden- und Grundwassermanagement"},{"uid":123,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/rosi-ritter.html","title":"Ms. Ritter, Rosi","name":"Ritter Rosi","faculty":4,"luf":"Lehrerbildung f\u00fcr Schulische Inklusion"},{"uid":704,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/verena-ronge-1.html","title":"Ms. Dr. Ronge, Verena","name":"Ronge Verena","faculty":1,"luf":"Germanistik \/ Didaktik der deutschen Sprache und Literatur \/ Schwerpunkt Literatur"},{"uid":483,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sandra-rosalen.html","title":"Ms. Rosalen, Sandra","name":"Rosalen Sandra","faculty":6,"luf":"Verpackung"},{"uid":277,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marion-rose.html","title":"Ms. Dr. Rose, Marion","name":"Rose Marion","faculty":6,"luf":"Medien\u00f6konomie \/ Innovationsmamagement"},{"uid":507,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anja-rosen.html","title":"Ms. Rosen, Anja","name":"Rosen Anja","faculty":5,"luf":"Baukonstruktion | Entwurf | Materialkunde"},{"uid":1066,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/robert-roth.html","title":"Mr. Roth, Robert","name":"Roth Robert","faculty":6,"luf":"Angewandte Informatik"},{"uid":838,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/matthias-rottmann-1.html","title":"Mr. Dr. Rottmann, Matthias","name":"Rottmann Matthias","faculty":4,"luf":"Angewandte Informatik"},{"uid":247,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/katharina-ruecker-m-a.html","title":"Ms. R\u00fccker, Katharina","name":"R\u00fccker Katharina","faculty":1,"luf":"Germanistische Sprachwissenschaft"},{"uid":1120,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/meike-ruehl.html","title":"Ms. PD Dr. R\u00fchl, Meike","name":"R\u00fchl Meike","faculty":1,"luf":"Klassische Philologie"},{"uid":187,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christian-rupietta.html","title":"Mr. Prof. Dr. Rupietta, Christian","name":"Rupietta Christian","faculty":3,"luf":"Betriebswirtschaftslehre, insb. Innovation"},{"uid":664,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jean-ruppenthal.html","title":"Mr. PD Dr. Ruppenthal, Jean","name":"Ruppenthal Jean","faculty":4,"luf":"Reine Mathematik \/ Komplexe Analysis"},{"uid":137,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/matthias-ruerup.html","title":"Mr. Dr. R\u00fcrup, Matthias","name":"R\u00fcrup Matthias","faculty":30,"luf":"Schultheorie und Schulentwicklung"},{"uid":1188,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/patrick-sahle.html","title":"Mr. Prof. Dr. Sahle, Patrick","name":"Sahle Patrick","faculty":1,"luf":"Digital Humanities \/ Mittelalterliche Geschichte"},{"uid":646,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/gabriele-sander-3.html","title":"Ms. Prof. Dr. Sander, Gabriele","name":"Sander Gabriele","faculty":1,"luf":"Germanistik"},{"uid":429,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marisa-sandhoff.html","title":"Ms. Dr. Sandhoff, Marisa","name":"Sandhoff Marisa","faculty":4,"luf":"Chemie"},{"uid":772,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christian-sauder.html","title":"Mr. Sauder, Christian","name":"Sauder Christian","faculty":7,"luf":"Konstruktion (Engineering Design)"},{"uid":229,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/alexander-saurbier.html","title":"Mr. Saurbier, Alexander","name":"Saurbier Alexander","faculty":5,"luf":"Bauphysik und Technische Geb\u00e4udeausr\u00fcstung"},{"uid":71,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andreas-schaarschuch.html","title":"Mr. Prof. Dr. Schaarschuch, Andreas","name":"Schaarschuch Andreas","faculty":2,"luf":"Sozialp\u00e4dagogik \/ Soziale Dienste"},{"uid":101,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/alexander-schaberg.html","title":"Mr. Schaberg, Alexander","name":"Schaberg Alexander","faculty":7,"luf":"Chemische Sicherheit und Abwehrender Brandschutz"},{"uid":533,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/lena-schalenbach.html","title":"Ms. Schalenbach, Lena","name":"Schalenbach Lena","faculty":5,"luf":"Baukonstruktion | Entwurf | Materialkunde"},{"uid":539,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-scheffel.html","title":"Mr. Prof. Dr. Scheffel , Michael","name":"Scheffel Michael","faculty":1,"luf":"Allgemeine und Vergleichende Literaturwissenschaft"},{"uid":638,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ullrich-scherf.html","title":"Mr. Univ-Prof. Dr. Scherf, Ullrich","name":"Scherf Ullrich","faculty":4,"luf":0},{"uid":842,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-schimp.html","title":"Mr. Schimp, Michael","name":"Schimp Michael","faculty":4,"luf":"Astrophysik"},{"uid":581,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sebastian-schipporeit.html","title":"Mr. Schipporeit, Sebastian","name":"Schipporeit Sebastian","faculty":7,"luf":"Materialwissenschaft und Werkstofftechnik"},{"uid":1004,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sabine-schlag-2.html","title":"Ms. Dr. Schlag, Sabine","name":"Schlag Sabine","faculty":9,"luf":"Lehr-, Lern- und Unterrichsforschung"},{"uid":423,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/andreas-schlenkhoff.html","title":"Mr. Univ.-Prof Dr.-Ing. Schlenkhoff, Andreas","name":"Schlenkhoff Andreas","faculty":5,"luf":"Wasserwirtschaft und Wasserbau"},{"uid":375,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/simon-schlesinger.html","title":"Mr. Schlesinger, Simon","name":"Schlesinger Simon","faculty":4,"luf":"Bildgebende Systeme"},{"uid":283,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/nadine-schlueter.html","title":"Ms. Dr.-Ing. Schl\u00fcter, Nadine","name":"Schl\u00fcter Nadine","faculty":7,"luf":"Produktsicherheit und Qualit\u00e4tswesen"},{"uid":413,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/lars-schmelter.html","title":"Mr. Univ.-Prof Dr.-Ing. Schmelter, Lars","name":"Schmelter Lars","faculty":1,"luf":"Didaktik des Franz\u00f6sischen"},{"uid":85,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/eberhard-schmidt.html","title":"Mr. Univ.-Prof Dr.-Ing. habil. Schmidt, Eberhard","name":"Schmidt Eberhard","faculty":7,"luf":"Sicherheitstechnik \/ Umweltschutz"},{"uid":257,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/karl-heinrich-schmidt.html","title":"Mr. Prof. Dr. Schmidt, Karl-Heinrich","name":"Schmidt Karl-Heinrich","faculty":6,"luf":"Elektronische Medien"},{"uid":1054,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/martin-schmidt.html","title":"Mr. Schmidt, Martin","name":"Schmidt Martin","faculty":1,"luf":"Klassische Philologie"},{"uid":1014,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stefan-schmidt.html","title":"Mr. Dr. Schmidt, Stefan","name":"Schmidt Stefan","faculty":1,"luf":"Bildungsphilosophie und Bildungsgeschichte"},{"uid":744,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/norina-schmidtseifer.html","title":"Ms. Schmidtseifer, Norina","name":"Schmidtseifer Norina","faculty":7,"luf":"Neue Fertigungsverfahren und Werkstoffe"},{"uid":652,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/katrin-schmitz.html","title":"Ms. PD Dr. Schmitz, Katrin","name":"Schmitz Katrin","faculty":1,"luf":"Romanische Sprachwissenschaft, Mehrsprachigkeitsforschung"},{"uid":431,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/benedikt-schmuelling.html","title":"Mr. Prof. Dr.-Ing. Schm\u00fclling, Benedikt","name":"Schm\u00fclling Benedikt","faculty":6,"luf":"Elektromobilit\u00e4t"},{"uid":1046,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kerstin-schneider.html","title":"Ms. Prof. Dr. Schneider, Kerstin","name":"Schneider Kerstin","faculty":3,"luf":"Finanzwissenschaft"},{"uid":1078,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/uwe-schneidewind.html","title":"Mr. Prof. Dr. Schneidewind, Uwe","name":"Schneidewind Uwe","faculty":3,"luf":"Innovationsmanagement und Nachhaltigkeit"},{"uid":449,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/martina-schneller.html","title":"Ms. Dr.-Ing. Schneller, Martina","name":"Schneller Martina","faculty":5,"luf":"Baubetrieb und Bauwirtschaft"},{"uid":1154,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/katrin-schoenenberg.html","title":"Ms. Dr.-Ing. Schoenenberg, Katrin","name":"Schoenenberg Katrin","faculty":2,"luf":"Klinische Psychologie und Psychotherapie"},{"uid":95,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/antina-scholz.html","title":"Ms. Scholz, Antina","name":"Scholz Antina","faculty":1,"luf":"Wissenschaftsgeschichte"},{"uid":1034,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christine-schrettenbrunner.html","title":"Ms. Schrettenbrunner, Christine","name":"Schrettenbrunner Christine","faculty":7,"luf":"Psychologie"},{"uid":654,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/heiko-schroeder.html","title":"Mr. Schroeder, Heiko","name":"Schroeder Heiko","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":291,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/daniela-schulz.html","title":"Ms. Schulz, Daniela","name":"Schulz Daniela","faculty":1,"luf":"Mittelalterliche Geschichte"},{"uid":357,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ralf-schulze.html","title":"Mr. Prof. Dr. Schulze, Ralf","name":"Schulze Ralf","faculty":2,"luf":"Methodenlehre und Psychologische Diagnostik"},{"uid":367,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/axel-schumacher.html","title":"Mr. Univ.-Prof Dr.-Ing. Schumacher, Axel","name":"Schumacher Axel","faculty":7,"luf":"Optimierung mechanischer Strukturen"},{"uid":203,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/susanne-schwab.html","title":"Ms. Prof. Dr. Schwab, Susanne","name":"Schwab Susanne","faculty":9,"luf":"Lehrerbildung f\u00fcr Schulische Inklusion"},{"uid":223,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/karl-schwalbenhofer.html","title":"Mr. Univ.-Prof Dr.-Ing. Schwalbenhofer, Karl","name":"Schwalbenhofer Karl","faculty":5,"luf":"Tragwerklehre und Baukonstruktion"},{"uid":904,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/patrick-schwarz.html","title":"Mr. Schwarz, Patrick","name":"Schwarz Patrick","faculty":7,"luf":"Werkstofftechnik"},{"uid":103,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sascha-schwarz.html","title":"Mr. Dr. Schwarz, Sascha","name":"Schwarz Sascha","faculty":2,"luf":"Sozialpsychologie"},{"uid":255,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/wolfgang-schwarz.html","title":"Mr. Prof. Dr. Schwarz, Wolfgang","name":"Schwarz Wolfgang","faculty":4,"luf":"Didaktik der Mathematik"},{"uid":419,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/miriam-schwedler.html","title":"Ms. Schwedler, Miriam","name":"Schwedler Miriam","faculty":5,"luf":"Stra\u00dfenverkehrsplanung und -technik"},{"uid":846,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/katharina-schwenzer.html","title":"Ms. Schwenzer, Katharina","name":"Schwenzer Katharina","faculty":5,"luf":"Baumechanik und Numerische Methoden"},{"uid":1100,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/heike-seehagen-marx.html","title":"Ms. Dr. Seehagen-Marx, Heike","name":"Seehagen-Marx Heike","faculty":30,"luf":"Digitalgest\u00fctze Lehr- und Lernumgebungen"},{"uid":531,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/johanna-katharina-seggewies.html","title":"Ms. Seggewies, Johanna- Katharina","name":"Seggewies Johanna- Katharina","faculty":5,"luf":"Baukonstruktion | Entwurf | Materialkunde"},{"uid":1016,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ulrich-seiss.html","title":"Mr. Seiss, Ulrich","name":"Seiss Ulrich","faculty":8,"luf":"Farbtechnik\/ Raumgestaltung\/ Oberfl\u00e4chentechnik"},{"uid":475,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/alina-sersch.html","title":"Ms. Sersch, Alina","name":"Sersch Alina","faculty":7,"luf":"Konstruktion (Engineering Design)"},{"uid":1122,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/klaus-dieter-setzer.html","title":"Mr. Dr. Setzer, Klaus-Dieter","name":"Setzer Klaus-Dieter","faculty":4,"luf":"Physikalische Chemie"},{"uid":421,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/armin-seyfried.html","title":"Mr. Seyfried, Armin","name":"Seyfried Armin","faculty":5,"luf":"Computersimulation f\u00fcr Brandschutz und Fu\u00dfg\u00e4ngerverkehr"},{"uid":601,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/julia-siedle.html","title":"Ms. Siedle, Julia","name":"Siedle Julia","faculty":5,"luf":"Bauplanungsrecht (formelle und informelle Instrumente)"},{"uid":599,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tanja-siems-1.html","title":"Ms. Prof. Dr.-Ing. Siems, Tanja","name":"Siems Tanja","faculty":5,"luf":"Bauplanungsrecht (formelle und informelle Instrumente)"},{"uid":551,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/katharina-simon.html","title":"Ms. Simon, Katharina","name":"Simon Katharina","faculty":5,"luf":"Bauplanungsrecht (formelle und informelle Instrumente)"},{"uid":105,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marko-sonder.html","title":"Mr. Sonder, Marko","name":"Sonder Marko","faculty":5,"luf":"\u00d6ffentliche Verkehrssysteme und Mobilit\u00e4tsmanagement"},{"uid":79,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stefan-soter.html","title":"Mr. Univ.-Prof Dr.-Ing. Soter, Stefan","name":"Soter Stefan","faculty":6,"luf":"Elektrische Maschinen und Antriebe"},{"uid":89,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/guido-spars.html","title":"Mr. Univ.-Prof Dr.-Ing. habil. Spars, Guido","name":"Spars Guido","faculty":5,"luf":"\u00d6konomie des Planens und Bauens"},{"uid":940,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/birgit-spengler.html","title":"Ms. Prof. Dr. Spengler, Birgit","name":"Spengler Birgit","faculty":1,"luf":"Amerikanistik"},{"uid":1080,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/olivia-spiker.html","title":"Ms. Spiker, Olivia","name":"Spiker Olivia","faculty":5,"luf":"\u00d6ffentliche Verkehrssysteme und Mobilit\u00e4tsmanagement"},{"uid":1134,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/daniel-spruth.html","title":"Mr. Spruth, Daniel","name":"Spruth Daniel","faculty":5,"luf":"Baukultur und Raumgestaltung"},{"uid":405,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/philipp-steffens.html","title":"Mr. Dr. Steffens, Philipp","name":"Steffens Philipp","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":59,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/elisabeth-stein.html","title":"Ms. Univ-Prof. Dr. Stein, Elisabeth","name":"Stein Elisabeth","faculty":1,"luf":"Latinistik"},{"uid":297,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/theodor-stemper.html","title":"Mr. Prof. Dr. Stemper, Theodor","name":"Stemper Theodor","faculty":2,"luf":"Sportwissenschaft"},{"uid":455,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-stiglmayr-1.html","title":"Mr. Dr. Stiglmayr, Michael","name":"Stiglmayr Michael","faculty":4,"luf":"Mathematische Optimierung"},{"uid":259,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/melanie-stralla.html","title":"Ms. Stralla, Melanie","name":"Stralla Melanie","faculty":1,"luf":"Allgemeine und Vergleichende Literaturwissenschaft"},{"uid":832,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/artur-strebel.html","title":"Mr. Strebel, Artur","name":"Strebel Artur","faculty":4,"luf":"Angewandte Informatik"},{"uid":1150,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/vilma-symanczyk-joppe.html","title":"Ms. Symanczyk Joppe, Vilma","name":"Symanczyk Joppe Vilma","faculty":1,"luf":"Germanistische Sprachwissenschaft"},{"uid":595,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-tausch.html","title":"Mr. Prof. Dr. Tausch, Michael","name":"Tausch Michael","faculty":4,"luf":"Photochemie in der Lehre der MINT-F\u00e4cher"},{"uid":451,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/anne-timmermann.html","title":"Ms. Timmermann, Anne","name":"Timmermann Anne","faculty":5,"luf":"Stra\u00dfenverkehrsplanung und -technik"},{"uid":962,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/antoine-tordeux.html","title":"Mr. Jun.-Prof. Dr. Tordeux, Antoine","name":"Tordeux Antoine","faculty":7,"luf":0},{"uid":309,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/heinz-reiner-treichel.html","title":"Mr. Univ-Prof. Dr. Treichel, Heinz-Reiner","name":"Treichel Heinz-Reiner","faculty":6,"luf":"Medien\u00f6konomie \/ Innovationsmamagement"},{"uid":1002,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kati-trempler.html","title":"Ms. Dr. Trempler, Kati","name":"Trempler Kati","faculty":9,"luf":"Lehr-, Lern- und Unterrichsforschung"},{"uid":443,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/aytuere-tuerkyilmaz.html","title":"Ms. T\u00fcrkyilmaz, Ayt\u00fcre","name":"T\u00fcrkyilmaz Ayt\u00fcre","faculty":2,"luf":"Kindheitssoziologie"},{"uid":185,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/dietmar-tutsch.html","title":"Mr. Univ.-Prof Dr.-Ing. habil. Tutsch, Dietmar","name":"Tutsch Dietmar","faculty":6,"luf":"Automatisierungstechnik \/ Informatik"},{"uid":874,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/susanne-uhmann.html","title":"Ms. Prof. Dr. Uhmann, Susanne","name":"Uhmann Susanne","faculty":1,"luf":"Germanistische Sprachwissenschaft"},{"uid":1052,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/carmen-ulrich.html","title":"Ms. PD Dr. Ulrich, Carmen","name":"Ulrich Carmen","faculty":1,"luf":"Allgemeine und Vergleichende Literaturwissenschaft"},{"uid":509,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/peter-urban.html","title":"Mr. Prof. Dr.-Ing. Urban, Peter","name":"Urban Peter","faculty":6,"luf":"Druckverfahrenstechnik"},{"uid":571,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/diemo-urbig.html","title":"Mr. Jun.-Prof. Dr. Urbig, Diemo","name":"Urbig Diemo","faculty":3,"luf":"Unternehmensgr\u00fcndung und Wirtschaftsentwicklung"},{"uid":1132,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/frederic-van-gen-hassend.html","title":"Mr. van gen Hassend, Frederic","name":"van gen Hassend Frederic","faculty":7,"luf":"Materialwissenschaft und Werkstofftechnik"},{"uid":313,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marij-van-strien.html","title":"Ms. Dr. van Strien, Marij","name":"van Strien Marij","faculty":1,"luf":"Theorie und Geschichte der Wissenschaften"},{"uid":131,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/joerg-velten.html","title":"Mr. Dr.-Ing. Velten, J\u00f6rg","name":"Velten J\u00f6rg","faculty":6,"luf":"Theorie und Anwendung mehrdimensionaler Signale und Systeme"},{"uid":868,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/rowena-verst.html","title":"Ms. Verst, Rowena","name":"Verst Rowena","faculty":5,"luf":"Geotechnik"},{"uid":1008,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/monika-vogel-1.html","title":"Ms. Jun.-Prof. Dr. Vogel, Monika","name":"Vogel Monika","faculty":1,"luf":"Didaktik des Lateinischen"},{"uid":752,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ludgera-vogt.html","title":"Ms. Univ-Prof. Dr. Vogt, Ludgera","name":"Vogt Ludgera","faculty":2,"luf":"Handlungs- und Interaktionstheorien"},{"uid":69,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christine-k-volkmann.html","title":"Ms. Univ-Prof. Dr. Volkmann, Christine K.","name":"Volkmann Christine K.","faculty":3,"luf":"Unternehmensgr\u00fcndung und Wirtschaftsentwicklung"},{"uid":1010,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/frank-von-danwitz.html","title":"Mr. von Danwitz, Frank","name":"von Danwitz Frank","faculty":30,"luf":"Digitale Medien"},{"uid":221,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/karsten-voss.html","title":"Mr. Prof. Dr.-Ing. Voss, Karsten","name":"Voss Karsten","faculty":5,"luf":"Bauphysik und Technische Geb\u00e4udeausr\u00fcstung"},{"uid":251,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/wolfgang-wagner.html","title":"Mr. Univ-Prof. Dr. Wagner, Wolfgang","name":"Wagner Wolfgang","faculty":4,"luf":"Chemie"},{"uid":73,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/gerrit-walther.html","title":"Mr. Univ-Prof. Dr. Walther, Gerrit","name":"Walther Gerrit","faculty":1,"luf":"Geschichte der Fr\u00fchen Neuzeit"},{"uid":750,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stephan-wardzala.html","title":"Ms. Wardzala, Stephan","name":"Wardzala Stephan","faculty":5,"luf":"Bauplanungsrecht (formelle und informelle Instrumente)"},{"uid":1128,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christa-warnke-1.html","title":"Ms. Warnke, Christa","name":"Warnke Christa","faculty":1,"luf":"Jazzgesang"},{"uid":1144,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/peter-wastl.html","title":"Mr. Dr. Wastl, Peter","name":"Wastl Peter","faculty":2,"luf":"Integrative Theorie und Praxis des Sports"},{"uid":51,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sebastian-weber.html","title":"Mr. Prof. Dr.-Ing. Weber, Sebastian","name":"Weber Sebastian","faculty":7,"luf":"Materialwissenschaft und Werkstofftechnik"},{"uid":794,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ralf-wegener.html","title":"Mr. Dr.-Ing. Wegener, Ralf","name":"Wegener Ralf","faculty":6,"luf":"Elektrische Maschinen und Antriebe"},{"uid":706,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/udo-wehmeier.html","title":"Mr. PD Dr. Wehmeier, Udo","name":"Wehmeier Udo","faculty":2,"luf":"Sportmedizin"},{"uid":1044,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stefan-weise-1.html","title":"Mr. Jun.-Prof. Dr. Weise, Stefan","name":"Weise Stefan","faculty":1,"luf":"Klassische Philologie"},{"uid":109,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/ulrich-weiss.html","title":"Mr. Wei\u00df, Ulrich","name":"Wei\u00df Ulrich","faculty":2,"luf":"Erziehungswissenschaft mit dem Schwerpunkt Berufs- und Weiterbildung"},{"uid":1184,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/antonius-weixler.html","title":"Mr. Dr. Weixler, Antonius","name":"Weixler Antonius","faculty":1,"luf":"Germanistik"},{"uid":391,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/matthias-wellandt.html","title":"Mr. Dr. Wellandt, Matthias","name":"Wellandt Matthias","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":161,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/franz-westermaier.html","title":"Mr. Dr. Westermaier, Franz","name":"Westermaier Franz","faculty":3,"luf":"Quantitative Methoden der empirischen Sozialforschung und Sozialstrukturanalyse"},{"uid":1086,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sven-wielens.html","title":"Mr. Wielens, Sven","name":"Wielens Sven","faculty":7,"luf":"Optimierung mechanischer Strukturen"},{"uid":407,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/peter-wiesen.html","title":"Mr. Univ-Prof. Dr. Wiesen, Peter","name":"Wiesen Peter","faculty":4,"luf":"Physikalische Chemie"},{"uid":1176,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/jeannette-windheuser-1.html","title":"Ms. Dr. Windheuser, Jeannette","name":"Windheuser Jeannette","faculty":2,"luf":"Bildungsphilosophie und Bildungsgeschichte"},{"uid":315,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/petra-winzer.html","title":"Ms. Univ.-Prof Dr.-Ing. habil. Winzer, Petra","name":"Winzer Petra","faculty":7,"luf":"Produktsicherheit und Qualit\u00e4tswesen"},{"uid":575,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/peter-witt.html","title":"Mr. Prof. Dr. Witt, Peter","name":"Witt Peter","faculty":3,"luf":"Betriebswirtschaftslehre, insb. Innovation"},{"uid":545,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kai-dietrich-wolf.html","title":"Mr. Univ.-Prof Dr.-Ing. Wolf, Kai-Dietrich","name":"Wolf Kai-Dietrich","faculty":7,"luf":"Mechatronik"},{"uid":3,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/kristian-wolf.html","title":"Mr. Univ.-Prof. Wolf, Kristian","name":"Wolf Kristian","faculty":8,"luf":"Design Interaktiver Medien"},{"uid":97,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/daniel-wolter.html","title":"Mr. Wolter, Daniel","name":"Wolter Daniel","faculty":6,"luf":"Energietechnik"},{"uid":694,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/hans-bernhard-woyand.html","title":"Mr. Univ.-Prof Dr.-Ing. Woyand, Hans-Bernhard","name":"Woyand Hans-Bernhard","faculty":7,"luf":"Maschinenbau-Informatik"},{"uid":355,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/julian-wruk.html","title":"Mr. Wruk, Julian","name":"Wruk Julian","faculty":6,"luf":"Elektrische Energieversorgung"},{"uid":692,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/oliver-wulf.html","title":"Mr. Wulf, Oliver","name":"Wulf Oliver","faculty":2,"luf":"Sportwissenschaft"},{"uid":1124,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/sabrina-wuellner.html","title":"Ms. W\u00fcllner, Sabrina","name":"W\u00fcllner Sabrina","faculty":2,"luf":"Bildungsforschung in Sambia"},{"uid":1168,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/christian-wyss.html","title":"Mr. Dr. Wyss, Christian","name":"Wyss Christian","faculty":4,"luf":"Funktionalanalysis"},{"uid":998,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/tian-xiong.html","title":"Ms. Xiong, Tian","name":"Xiong Tian","faculty":3,"luf":"Makro\u00f6konomik"},{"uid":914,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/abdullah-yavuz-1.html","title":"Mr. Yavuz, Abdullah","name":"Yavuz Abdullah","faculty":3,"luf":"Finanzwissenschaft"},{"uid":852,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/yasemin-yurdanur.html","title":"Ms. Yurdanur, Yasemin","name":"Yurdanur Yasemin","faculty":4,"luf":"Didaktik der Chemie"},{"uid":179,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/markus-zdrallek.html","title":"Mr. Univ.-Prof Dr.-Ing. Zdrallek, Markus","name":"Zdrallek Markus","faculty":6,"luf":"3D-Druck & Additive Fertigung"},{"uid":1182,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/diana-zeller-1.html","title":"Ms. Zeller, Diana","name":"Zeller Diana","faculty":4,"luf":"Didaktik der Chemie"},{"uid":379,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/qian-zhang.html","title":"Mr. Dr.-Ing. Zhang, Qian","name":"Zhang Qian","faculty":7,"luf":"Sicherheitstechnik \/ Umweltschutz"},{"uid":183,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/michael-zibell.html","title":"Mr. Zibell, Michael","name":"Zibell Michael","faculty":5,"luf":"Baubetrieb und Bauwirtschaft"},{"uid":726,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/annette-ziegenmeyer.html","title":"Ms. Dr. Ziegenmeyer, Annette","name":"Ziegenmeyer Annette","faculty":1,"luf":"Didaktik der Musik"},{"uid":786,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/corinna-ziegler.html","title":"Ms. Ziegler, Corinna","name":"Ziegler Corinna","faculty":9,"luf":"Empirische Forschungsmethoden"},{"uid":293,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/stephan-zielke.html","title":"Mr. Prof. Dr. Zielke, Stephan","name":"Zielke Stephan","faculty":3,"luf":"Multi-Channel-Management"},{"uid":828,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/marcel-zillgitt.html","title":"Mr. Zillgitt, Marcel","name":"Zillgitt Marcel","faculty":7,"luf":"Sicherheitstechnik \/ Umweltschutz"},{"uid":1166,"url":"http:\/\/\/en\/scientistdatabase\/scientists\/show\/scientist\/peter-zimmermann.html","title":"Mr. Univ-Prof. Dr. Zimmermann, Peter","name":"Zimmermann Peter","faculty":2,"luf":"Entwicklungspsychologie der Lebensspanne"}],"methods":[{"uid":191,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/ab-inito-simulationsverfahren.html","name":"ab inito Simulationsverfahren"},{"uid":277,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/algorithmenentwicklung.html","name":"Algorithmenentwicklung"},{"uid":363,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/algorithmenentwicklung-1.html","name":"Algorithmenentwicklung"},{"uid":79,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/algorithmenentwicklung-und-implementation.html","name":"Algorithmenentwicklung und -implementation"},{"uid":165,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/analyse-multimodaler-interaktion.html","name":"Analyse multimodaler Interaktion"},{"uid":403,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/analyse-von-versorgungsaufgaben.html","name":"Analyse von Versorgungsaufgaben"},{"uid":241,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/analytische-zuverlaessigkeitsberechnung.html","name":"Analytische Zuverl\u00e4ssigkeitsberechnung"},{"uid":443,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/arbeitsphysiologie.html","name":"Arbeitsphysiologie"},{"uid":535,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/archiv-und-bauforschung.html","name":"Archiv.- und Bauforschung"},{"uid":209,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/augmented-reality.html","name":"Augmented Reality"},{"uid":427,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/azide.html","name":"Azide"},{"uid":77,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/befragungen.html","name":"Befragungen"},{"uid":395,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/belastungs-dokumentations-system-bds.html","name":"Belastungs-Dokumentations-System"},{"uid":435,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/belastungs-dokumentations-system-bds-1.html","name":"Belastungs-Dokumentations-System (BDS)"},{"uid":437,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/belastungs-dokumentations-system-bds-2.html","name":"Belastungs-Dokumentations-System (BDS)"},{"uid":397,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/beurteilung-arbeitsbedingter-belastungen-bab-verfahren.html","name":"Beurteilung arbeitsbedingter Belastungen (BAB-Verfahren)"},{"uid":439,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/beurteilung-arbeitsbedingter-belastungen-bab-verfahren-1.html","name":"Beurteilung arbeitsbedingter Belastungen (BAB-Verfahren)"},{"uid":257,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/bewertungssystematiken.html","name":"Bewertungssystematiken"},{"uid":303,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/big-data.html","name":"Big Data"},{"uid":177,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/bildung-deduktiver-theorien.html","name":"Bildung deduktiver Theorien"},{"uid":519,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/bildwissenschaft.html","name":"Bildwissenschaft"},{"uid":131,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/blitzstossspannungspruefung-bis-800-kv.html","name":"Blitzsto\u00dfspannungspr\u00fcfung bis 800 kV"},{"uid":8,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/bow-tie.html","name":"BOW-TIE"},{"uid":383,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/business-process-management.html","name":"Business Process Management"},{"uid":337,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/cc.html","name":"C\/C++"},{"uid":65,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/fallstudien-studierenden-befragungen.html","name":"Case Studies, Student Surveys"},{"uid":10,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/checklistenverfahren-im-arbeitsschutz.html","name":"Checklistenverfahren im Arbeitsschutz"},{"uid":155,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/chemische-analytik.html","name":"Chemische Analytik"},{"uid":355,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/computational-electromagnetics.html","name":"Computational Electromagnetics"},{"uid":149,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/computational-fluid-dynamics.html","name":"Computational Fluid Dynamics"},{"uid":43,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/computational-thermodynamics-calphad.html","name":"Computational Thermodynamics (Calphad)"},{"uid":467,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/concept-mapping.html","name":"Concept Mapping"},{"uid":335,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/cplex.html","name":"CPLEX"},{"uid":447,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/data-mining.html","name":"Data Mining"},{"uid":323,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/datenbanken.html","name":"Datenbanken"},{"uid":3,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/design-thinking.html","name":"Design Thinking"},{"uid":185,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/detektorauslese-mit-hoher-bandbreite.html","name":"Detektorauslese mit hoher Bandbreite"},{"uid":501,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/didaktische-analyse.html","name":"Didaktische Analyse"},{"uid":483,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/digitalelektronik.html","name":"Digitalelektronik"},{"uid":51,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/diskursanalyse.html","name":"Diskursanalyse"},{"uid":361,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/eigenwertalgorithmen.html","name":"Eigenwertalgorithmen"},{"uid":12,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/einfaches-massnahmenkonzept-gefahrstoffe.html","name":"Einfaches Ma\u00dfnahmenkonzept Gefahrstoffe"},{"uid":331,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/einsatzdatenauswertung.html","name":"Einsatzdatenauswertung"},{"uid":401,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/einwohnerbefragungen.html","name":"Einwohnerbefragungen"},{"uid":421,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/einzelphoton-detektion.html","name":"Einzelphoton-Detektion"},{"uid":521,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/elektroenzephalographie.html","name":"Elektroenzephalographie"},{"uid":353,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/elektromagnetische-feldberechnung.html","name":"Elektromagnetische Feldberechnung"},{"uid":311,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/elektronikentwicklung.html","name":"Elektronikentwicklung"},{"uid":97,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/empirische-forschungsmethoden.html","name":"Empirische Forschungsmethoden"},{"uid":263,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/energiedispersive-roentgendiffraktometrie-an-ausgedehnten-objekten.html","name":"Energiedispersive R\u00f6ntgendiffraktometrie an ausgedehnten Objekten"},{"uid":411,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/entwicklung-und-evaluierung-von-lehr-lernmaterialien.html","name":"Entwicklung und Evaluierung von Lehr-\/Lernmaterialien"},{"uid":409,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/entwicklung-von-modellexperimenten.html","name":"Entwicklung von Modellexperimenten"},{"uid":167,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/ereignisstudien.html","name":"Ereignisstudien"},{"uid":301,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/erhebungsmethoden.html","name":"Erhebungsmethoden"},{"uid":141,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/erwaermungsversuche-durch-hochstrom-2500-a.html","name":"Erw\u00e4rmungsversuche durch Hochstrom 2500 A"},{"uid":213,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/ethnographie-der-kommunikation.html","name":"Ethnographie der Kommunikation"},{"uid":111,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/experiment.html","name":"Experiment"},{"uid":413,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/experteninterviews.html","name":"Experteninterviews"},{"uid":479,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/extremwerte-und-risiokoanalyse.html","name":"Extremwerte und Risiokoanalyse"},{"uid":349,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/fdtd-simulationen.html","name":"FDTD Simulationen"},{"uid":9,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/fehlerbaumanalyse.html","name":"Fehlerbaumanalyse"},{"uid":253,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/fernerkundung.html","name":"Fernerkundung"},{"uid":489,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/field-programmable-gate-arrays-fpgas.html","name":"Field Programmable Gate Arrays (FPGAs)"},{"uid":103,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/fragebogen.html","name":"Fragebogen"},{"uid":431,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/fullerene.html","name":"Fullerene"},{"uid":525,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/funktionelle-magnetresonanztomographie-fmri.html","name":"funktionelle Magnetresonanztomographie"},{"uid":523,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/funktionielle-nah-infrarotspektroskopie-fnirs.html","name":"funktionielle Nah-Infrarotspektroskopie"},{"uid":249,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/gaschromatographie.html","name":"Gaschromatographie"},{"uid":529,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/generalized-additive-models.html","name":"Generalized additive models"},{"uid":419,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/genexpressionsanalysen.html","name":"Genexpressionsanalysen"},{"uid":371,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/genomanalyse.html","name":"Genomanalyse"},{"uid":515,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/interaktions-und-gespraechsforschung.html","name":"Gespr\u00e4chsforschung"},{"uid":163,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/gespraechsforschung-ethnomethodologische-konversationsanalyse.html","name":"Gespr\u00e4chsforschung"},{"uid":477,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/gis-und-informationssysteme.html","name":"GIS und Informationssysteme"},{"uid":429,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/goldkatalyse.html","name":"Goldkatalyse"},{"uid":357,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/gpu-computing.html","name":"GPU Computing"},{"uid":273,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/graphen-und-heuristikbasierte-methoden.html","name":"Graphen und Heuristikbasierte Methoden"},{"uid":55,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/hermeneutik.html","name":"Hermeneutik"},{"uid":151,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/high-performance-computing.html","name":"High Performance Computing"},{"uid":497,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/historisch-hermeneutische-methoden.html","name":"Historisch-hermeneutische Methoden"},{"uid":147,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/historisch-kritische-methode-1.html","name":"Historisch-kritische Methode"},{"uid":153,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/historisch-vergleichende-soziologie.html","name":"Historisch-Vergleichende Soziologie"},{"uid":471,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/hydraulische-modellversuche-im-wasserbau.html","name":"Hydraulische Modellversuche im Wasserbau"},{"uid":475,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/hydrometrie-und-messen-im-wasserbau.html","name":"Hydrometrie und Messen im Wasserbau"},{"uid":59,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/ikonologie.html","name":"Ikonologie"},{"uid":539,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/interdisziplinaritaet.html","name":"Interdisziplinarit\u00e4t"},{"uid":367,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/intervallarithmetik.html","name":"Intervallarithmetik"},{"uid":309,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/interviews.html","name":"Interviews"},{"uid":193,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/ionentrajektorienrechnungen.html","name":"Ionentrajektorienrechnungen"},{"uid":261,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/isolationsmessung-bis-30-kv.html","name":"Isolationsmessung bis 10 kV"},{"uid":351,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/kanalmodellierung.html","name":"Kanalmodellierung"},{"uid":217,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/kodikologie.html","name":"Kodikologie"},{"uid":487,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/kohlefaserstrukturen.html","name":"Kohlefaserstrukturen"},{"uid":491,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/kohortenstudie.html","name":"Kohortenstudie"},{"uid":81,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/komplexitaetsanalysen.html","name":"Komplexit\u00e4tsanalysen"},{"uid":137,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/konventionelle-teilentladungsmessung-nach-iec-60270.html","name":"Konventionelle Teilentladungsmessung nach IEC 60270"},{"uid":531,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/konversationsanalyse-conversation-analysis.html","name":"Konversationsanalyse \/ Conversation Analysis"},{"uid":405,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/konzepterstellung.html","name":"Konzepterstellung"},{"uid":407,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/konzeptvalidierung.html","name":"Konzeptvalidierung"},{"uid":279,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/korpuslinguistik.html","name":"Korpuslinguistik"},{"uid":199,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/kritische-edition.html","name":"Kritische Edition"},{"uid":541,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/kulturgeschichte.html","name":"Kulturgeschichte"},{"uid":175,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/laserspektroskopie.html","name":"Laserspektroskopie"},{"uid":229,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/lebenszyklusanalyse.html","name":"Lebenszyklusanalyse"},{"uid":393,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/leitmerkmalmethoden.html","name":"Leitmerkmalmethoden"},{"uid":441,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/leitmerkmalmethoden-1.html","name":"Leitmerkmalmethoden"},{"uid":445,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/leitmerkmalmethoden-2.html","name":"Leitmerkmalmethoden"},{"uid":527,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/linear-mixed-effects-models.html","name":"Linear mixed effects models"},{"uid":511,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/low-voltage-ride-through.html","name":"Low Voltage Ride Through"},{"uid":533,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/machine-learning.html","name":"Machine Learning"},{"uid":245,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/markov-modellierung.html","name":"Markov-Modellierung"},{"uid":169,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/massenspektrometrie.html","name":"Massenspektrometrie"},{"uid":47,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/materialauswahl.html","name":"Materialauswahl"},{"uid":93,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/materialforschung.html","name":"Materialforschung"},{"uid":321,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/matlab.html","name":"Matlab"},{"uid":63,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/medienhistorische-analyse.html","name":"Medienhistorische Analyse"},{"uid":457,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/mehrebenen-modelle.html","name":"Mehrebenen-Modelle"},{"uid":461,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/mehrebenenmodelle.html","name":"Mehrebenenmodelle"},{"uid":161,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/messtechnik.html","name":"Messtechnik"},{"uid":73,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/messtechnische-stroemungsanalyse-1.html","name":"messtechnische Str\u00f6mungsanalyse"},{"uid":231,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/metallografie.html","name":"Metallografie"},{"uid":359,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/methoden-der-rasterelektronen-und-der-rastersondenmikroskopie.html","name":"Methoden der Rasterelektronen- und der Rastersondenmikroskopie"},{"uid":509,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/mikrocontroller.html","name":"Mikrocontroller"},{"uid":481,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/mixed-methods.html","name":"Mixed Methods"},{"uid":201,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/modellentwicklung.html","name":"Modellentwicklung"},{"uid":495,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/modellentwicklung-und-rechnergestuetzte-simulation.html","name":"Modellentwicklung und rechnergest\u00fctzte Simulation"},{"uid":543,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/modellierung.html","name":"Modellierung"},{"uid":417,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/monte-carlo-simulationen.html","name":"Monte Carlo Simulationen"},{"uid":195,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/multiphysics-simulationen.html","name":"Multiphysics Simulationen"},{"uid":499,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/musikanalyse.html","name":"Musikanalyse"},{"uid":119,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/narratologie.html","name":"Narratologie"},{"uid":247,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/netzberechnung-elektrischer-netze.html","name":"Netzberechnung"},{"uid":243,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/netzplanung-elektrischer-netze.html","name":"Netzplanung elektrischer Netze"},{"uid":179,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/neuronale-netze.html","name":"Neuronale Netze"},{"uid":341,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/numerische-elektromagnetische-feldberechnung.html","name":"Numerische elektromagnetische Feldberechnung"},{"uid":379,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/numerische-lineare-algebra.html","name":"Numerische Lineare Algebra"},{"uid":473,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/numerische-simulationen-fuer-wasserbauwerke.html","name":"Numerische Simulationen f\u00fcr Wasserbauwerke"},{"uid":347,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/numerische-simulationen-komplexer-systeme-der-elektrischen-energieuebertragungstechnik.html","name":"Numerische Simulationen komplexer Systeme der elektrischen Energie\u00fcbertragungstechnik"},{"uid":1,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/objektorientierte-programmierung.html","name":"Object oriented programming"},{"uid":507,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/objektive-hermeneutik-oevermann.html","name":"Objektive Hermeneutik (Oevermann)"},{"uid":493,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/oekonometrie-und-quantitative-verfahren.html","name":"\u00d6konometrie und quantitative Verfahren"},{"uid":313,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/optimierungsverfahren.html","name":"Optimierungsverfahren"},{"uid":37,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/optionsbewertung.html","name":"Optionsbewertung"},{"uid":537,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/oral-history.html","name":"Oral History"},{"uid":215,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/palaeographie.html","name":"Pal\u00e4ographie"},{"uid":365,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/parallelisierung.html","name":"Parallelisierung"},{"uid":505,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/parametrischesgeneratives-entwerfen.html","name":"Parametrisches\/Generatives Entwerfen"},{"uid":157,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/particle-equilibrium-method-pem.html","name":"Particle Equilibrium Method (PEM)"},{"uid":433,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/peptide.html","name":"Peptide"},{"uid":449,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/petri-netze.html","name":"Petri-Netze"},{"uid":423,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/photomultiplier-sekundaerelektronen-vervielfacher.html","name":"Photomultiplier (Sekund\u00e4relektronen-Vervielfacher)"},{"uid":373,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/phylogenetische-sequenzanalysen.html","name":"phylogenetische Sequenzanalysen"},{"uid":183,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/pixeldetektoren.html","name":"Pixeldetektoren"},{"uid":333,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/praktische-erprobung-von-theorien.html","name":"Praktische Erprobung von Theorien"},{"uid":41,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/principal-agent-theorie.html","name":"Principal-Agent-Theorie"},{"uid":513,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/programmierung-von-embedded-systems.html","name":"Programmierung von Embedded Systems"},{"uid":327,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/prozessanalyse.html","name":"Prozessanalyse"},{"uid":369,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/qpcr-pcr-rt-pcr-klonieren.html","name":"qPCR, PCR, RT-PCR, Klonieren"},{"uid":415,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/qualitative-bildungsforschung.html","name":"Qualitative Bildungsforschung"},{"uid":469,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/qualitative-comparative-analysis-qca.html","name":"Qualitative Comparative Analysis (QCA)"},{"uid":91,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/qualitative-empirische-forschung.html","name":"Qualitative empirische Forschung"},{"uid":49,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/qualitative-und-quantitative-sozialforschung.html","name":"Qualitative und quantitative Sozialforschung"},{"uid":399,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/qualitative-und-quantitative-sozialforschung-1.html","name":"qualitative und quantitative Sozialforschung,"},{"uid":317,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/quantenmechanik.html","name":"Quantenmechanik"},{"uid":67,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/quantiative-empirische-forschung.html","name":"quantiative empirische Forschung"},{"uid":225,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/quantitative-bildanalyse.html","name":"Quantitative Bildanalyse"},{"uid":465,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/quantitative-forschung.html","name":"Quantitative Forschung"},{"uid":385,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/quantitative-sicherheitsanalyse.html","name":"Quantitative Sicherheitsanalyse"},{"uid":375,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/quantitative-und-qualitative-empirische-untersuchungen.html","name":"Quantitative und qualitative empirische Untersuchungen"},{"uid":189,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/reaktionskinetische-untersuchungen.html","name":"Reaktionskinetische Untersuchungen"},{"uid":345,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/rechnergestuetzten-elektromagnetische-umweltvertraeglichkeitsuntersuchungen.html","name":"Rechnergest\u00fctzten elektromagnetische Umweltvertr\u00e4glichkeitsuntersuchungen"},{"uid":121,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/religionsgeschichte.html","name":"Religionsgeschichte"},{"uid":57,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/rezeptionsaesthetik.html","name":"Rezeptions\u00e4sthetik"},{"uid":377,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/rheometrie.html","name":"Rheometrie"},{"uid":45,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/rietveld-methode.html","name":"Rietveld-Methode"},{"uid":391,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/risikoanalyse.html","name":"Risikoanalyse"},{"uid":4,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/risikobeurteilung.html","name":"Risikobeurteilung"},{"uid":389,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/roentgen-computertomographie.html","name":"R\u00f6ntgen-Computertomographie"},{"uid":265,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/roentgenstreu-computertomographie.html","name":"R\u00f6ntgenstreu-Computertomographie"},{"uid":143,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/schaltzeitmessung.html","name":"Schaltzeitmessung"},{"uid":115,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/screening.html","name":"Screening"},{"uid":339,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/sicherheitsaudit-fuer-strassen.html","name":"Sicherheitsaudit f\u00fcr Stra\u00dfen"},{"uid":181,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/siliziumdetektoren.html","name":"Siliziumdetektoren"},{"uid":159,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/simulation.html","name":"Simulation"},{"uid":267,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/simulationsgestuetzter-entwurf-von-roentgenbeugungssystemen.html","name":"Simulationsgest\u00fctzter Entwurf von R\u00f6ntgenbeugungssystemen"},{"uid":125,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/softwareentwicklung.html","name":"Softwareentwicklung"},{"uid":485,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/spurdetektoren.html","name":"Spurdetektoren"},{"uid":95,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/statistische-forschungsmethoden.html","name":"Statistische Forschungsmethoden"},{"uid":187,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/statistische-methoden.html","name":"Statistische Methoden"},{"uid":425,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/statistische-methoden-der-datenanalyse.html","name":"Statistische Methoden der Datenanalyse"},{"uid":453,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/stochastische-simulation.html","name":"stochastische Simulation"},{"uid":123,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/stochastische-verfahren.html","name":"Stochastische Verfahren"},{"uid":455,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/strukturgleichungsmodelle.html","name":"Strukturgleichungsmodelle"},{"uid":459,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/strukturgleichungsmodelle-1.html","name":"Strukturgleichungsmodelle"},{"uid":297,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/system-dynamics.html","name":"system dynamics"},{"uid":135,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/tan-delta-verlustfaktormessung.html","name":"Tan-Delta Verlustfaktormessung"},{"uid":71,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/temperaturfuehler.html","name":"Temperaturf\u00fchler"},{"uid":219,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/text-encoding-tei.html","name":"Text encoding (TEI)"},{"uid":145,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/thermografische-analysen-ir-thermografie.html","name":"Thermografische Analysen (IR-Thermografie)"},{"uid":275,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/topologieoptimierung.html","name":"Topologieoptimierung"},{"uid":53,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/triangulation.html","name":"Triangulation"},{"uid":139,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/unkonventionelle-teilentladungsmessung-akustisch-uhf-tev-hfct.html","name":"Unkonventionelle Teilentladungsmessung (akustisch, UHF, TEV, HFCT)"},{"uid":39,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/unternehmensbewertung.html","name":"Unternehmensbewertung"},{"uid":203,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/variantenauswertung.html","name":"Variantenauswertung"},{"uid":329,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/variationsberechnungen-1.html","name":"Variational calculations"},{"uid":11,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/verfahren-zur-gefaehrdungsbeurteilung.html","name":"Verfahren zur Gef\u00e4hrdungsbeurteilung"},{"uid":517,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/vergleichende-kunstgeschichte.html","name":"Vergleichende Kunstgeschichte"},{"uid":89,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/vergleichsstudien.html","name":"Vergleichsstudien"},{"uid":463,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/verkehrsbeobachtungen.html","name":"Verkehrsbeobachtungen"},{"uid":451,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/vhdl.html","name":"VHDL"},{"uid":305,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/videographie.html","name":"Videographie"},{"uid":211,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/virtual-reality.html","name":"Virtual Reality"},{"uid":133,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/vlf-pruefung-bis-24-kv.html","name":"VLF-Pr\u00fcfung bis 24 kV"},{"uid":387,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/vulnerabilitaetsanalyse.html","name":"Vulnerabilit\u00e4tsanalyse"},{"uid":503,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/vuv-uv-vis-spektroskopielaserionisationmassenspektrometrie.html","name":"VUV, UV-VIS Spektroskopie"},{"uid":171,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/vuv-uv-vis-ir-spektroskopie.html","name":"VUV, UV-VIS, IR Spektroskopie"},{"uid":127,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/wechselspannungpruefung-bis-300-kv.html","name":"Wechselspannungpr\u00fcfung bis 300 kV"},{"uid":129,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/wechselspannungspruefung-an-gasisolierten-schaltanlagen-bis-230-kv.html","name":"Wechselspannungspr\u00fcfung an gasisolierten Schaltanlagen bis 230 kV"},{"uid":61,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/werkanalyse.html","name":"Werkanalyse"},{"uid":227,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/werkstoffpruefung-1.html","name":"Werkstoffpr\u00fcfung"},{"uid":319,"url":"http:\/\/\/en\/scientistdatabase\/methods\/show\/method\/zeitreihenanalysen.html","name":"Zeitreihenanalysen"}],"devices":[{"uid":315,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/160kv-roentgenradiographie-anlage.html","name":"160kV-R\u00f6ntgenradiographie-Anlage"},{"uid":303,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/2-traegerfahrzeuge-fuer-testaufbauten-und-erprobung.html","name":"2 Engineering Cars"},{"uid":239,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/23-ghz-oszilloskop.html","name":"23 GHz Oszilloskop"},{"uid":345,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/3d-drucker-geeetech-i3-pro-x.html","name":"3D Drucker Geeetech i3 Pro X"},{"uid":307,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/3d-drucker-makerbot.html","name":"3D Drucker Makerbot"},{"uid":379,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/3d-konfokalmikroskop.html","name":"3D Konfokalmikroskop"},{"uid":421,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/3d-bewegungsanalyse.html","name":"3D-Bewegungsanalyse"},{"uid":143,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/3d-druck-forschungslabor.html","name":"3D-Druck-Forschungslabor"},{"uid":145,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/3d-druck-lernwerkstatt.html","name":"3D-Druck-Lernwerkstatt"},{"uid":341,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/abflussmessungen-hydrometrie.html","name":"Abflussmessungen - Hydrometrie"},{"uid":67,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/abschreck-und-umformdilatometrie.html","name":"Abschreck- und Umformdilatometrie"},{"uid":263,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/achatkugelmuehle.html","name":"Achatkugelm\u00fchle"},{"uid":51,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/aerosol-partikelgeneratoren.html","name":"Aerosol-Partikelgeneratoren"},{"uid":361,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/ansys-numerische-elektrischemagnetische-feldberechnung.html","name":"ANSYS (Numerische Magnetfeldberechnung)"},{"uid":531,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/arduino.html","name":"Arduino"},{"uid":435,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/aufdampfanlagen.html","name":"Aufdampfanlagen"},{"uid":455,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/aufdampfanlagen-1.html","name":"Aufdampfanlagen"},{"uid":71,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/auflicht-mikroskopie-und-quant-bildanalyse.html","name":"Auflicht-Mikroskopie und quant. Bildanalyse"},{"uid":349,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/augmented-reality-hololens.html","name":"Augmented Reality HoloLens"},{"uid":141,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/bam-fallhammer.html","name":"BAM-Fallhammer"},{"uid":6,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/beschleunigungsaufnehmer.html","name":"Beschleunigungsaufnehmer"},{"uid":5,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/beschleunigungssensor.html","name":"Beschleunigungssensor"},{"uid":385,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/bim-labor.html","name":"BIM Labor"},{"uid":373,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/bim-think-tank.html","name":"BIM Think-Tank"},{"uid":383,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/bim-think-tank-1.html","name":"BIM Think-Tank"},{"uid":245,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/biogeochemische-mikrokosmen.html","name":"Biogeochemische Mikrokosmen"},{"uid":189,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/blitzstossspannungsgenerator-800-kv.html","name":"Blitzsto\u00dfspannungsgenerator 800 kV"},{"uid":405,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/bogencoronaanlage.html","name":"Bogencoronaanlage"},{"uid":15,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/c-xsc-c-bibliothek-fuer-das-wissenschaftliche-rechnen.html","name":"C-XSC (C++-Library for Scientific Computing)"},{"uid":553,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/can-analysator.html","name":"CAN Analysator"},{"uid":523,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/chemilunineszenz-nox.html","name":"Chemilunineszenz (NOx)"},{"uid":497,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/chromatographie.html","name":"Chromatographie"},{"uid":359,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/comsol-multiphysics-feldsimulationen.html","name":"COMSOL (Multiphysics Feldsimulationen)"},{"uid":563,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/cone-kalorimeter.html","name":"Cone Kalorimeter"},{"uid":353,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/cst-suite-elektromagnetische-feldberechnung.html","name":"CST Suite (Elektromagnetische Feldberechnung)"},{"uid":297,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/dgps-mit-traegerfrequenzauswertung-2-cm-genauigkeit.html","name":"DGPS mit Tr\u00e4gerfrequenzauswertung (+- 2 cm Genauigkeit)"},{"uid":45,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/digital-lichtmikroskop.html","name":"Digital-Lichtmikroskop"},{"uid":479,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/digitales-lichtmikroskop-bis-1000-fache-vergroesserung.html","name":"Digitales Lichtmikroskop bis 1000-fache Vergr\u00f6\u00dferung"},{"uid":451,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/diverse-dehn-und-pressvorrichtungen.html","name":"diverse Dehn- und Pressvorrichtungen"},{"uid":471,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/diverse-dehn-und-pressvorrichtungen-1.html","name":"Diverse Dehn- und Pressvorrichtungen"},{"uid":403,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/diverse-drucksysteme-flexodruck-und-tiefdruck.html","name":"diverse Drucksysteme Flexodruck und Tiefdruck"},{"uid":401,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/diverse-farbmessgeraete-vis-und-uv-vis.html","name":"diverse Farbmessger\u00e4te (vis und UV-vis)"},{"uid":371,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/drohne.html","name":"Drohne"},{"uid":271,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/druckfiltrationseinheit.html","name":"Druckfiltrationseinheit"},{"uid":103,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/druckmesssonde-1.html","name":"Druckmesssonde"},{"uid":505,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/elektromyographie-emg.html","name":"Elektromyographie (EMG)"},{"uid":545,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/elektronische-last-gleichspannung-200kw.html","name":"Elektronische Last Gleichspannung 200kW"},{"uid":39,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/elementanalyse-mittels-energiedispersiver-roentgenspektroskopie-edx.html","name":"Elementanalyse mittels energiedispersiver R\u00f6ntgenspektroskopie EDX"},{"uid":43,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/environmental-scanning-electron-microscope.html","name":"Environmental Scanning Electron Microscope"},{"uid":507,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/ergometrie.html","name":"Ergometrie"},{"uid":235,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/experimentelle-raumzelle.html","name":"Experimentelle Raumzelle"},{"uid":423,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/eye-tracking-system.html","name":"Eye-Tracking-System"},{"uid":41,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/feinstaub-probennahme.html","name":"Feinstaub-Probennahme"},{"uid":355,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/feko-elektromagnetische-feldberechnung-von-antennenfeldern.html","name":"FEKO (Elektromagnetische Feldberechnung von Antennenfeldern)"},{"uid":519,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/flow-3d.html","name":"FLOW 3D"},{"uid":477,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/fluoreszenzphotometer.html","name":"Fluoreszenzphotometer"},{"uid":241,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/fpga-entwicklungskarten.html","name":"FPGA development boards"},{"uid":121,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/ftir-spektrometer.html","name":"FTIR-Spektrometer"},{"uid":489,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/ftir-spektroskopie.html","name":"FTIR-Spektroskopie"},{"uid":115,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/gaschromatograph.html","name":"Gaschromatograph"},{"uid":283,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/gaschromatograph-isotopenverhaeltnis-massenspektrometer-gc-c-irms.html","name":"Gaschromatograph-Isotopenverh\u00e4ltnis-Massenspektrometer (GC-C-IRMS)"},{"uid":285,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/gaschromatograph-isotopenverhaeltnis-massenspektrometer-gc-p-irms.html","name":"Gaschromatograph-Isotopenverh\u00e4ltnis-Massenspektrometer (GC-P-IRMS)"},{"uid":281,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/gaschromatograph-massenspektrometer-gc-ms.html","name":"Gaschromatograph-Massenspektrometer"},{"uid":187,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/gasisolierte-schaltanlage-sf6-230-kv.html","name":"Gasisolierte Schaltanlage (SF6) 230 kV"},{"uid":529,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/gaussian16.html","name":"Gaussian16"},{"uid":397,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/geeetech-i3-a-fdm-drucker.html","name":"Geeetech i3 A FDM Drucker"},{"uid":569,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/geraete-des-instituts-fuer-konstruktiven-ingenieurbau.html","name":"Ger\u00e4te des Instituts f\u00fcr Konstruktiven Ingenieurbau"},{"uid":381,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/glanzmessgeraet.html","name":"Glansmessger\u00e4t"},{"uid":541,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/gleichspannungsquelle-0-1000v-0-600a-200kw.html","name":"Gleichspannungsquelle 0-1000V 0-600A 200kW"},{"uid":419,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/hartmannrohr.html","name":"Hartmannrohr"},{"uid":109,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/highspeedkamera-1.html","name":"Highspeedkamera"},{"uid":565,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/hochgeschwindigkeitskamera.html","name":"Hochgeschwindigkeitskamera"},{"uid":213,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/hochspannungslabor.html","name":"Hochspannungslabor"},{"uid":195,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/hochstromtransformator-bis-2500-a-ac.html","name":"Hochstromtransformator bis 2500 A (AC)"},{"uid":343,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/htc-vive.html","name":"HTC Vive"},{"uid":247,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/induktiv-gekoppeltes-plasma-optisches-emissions-spektrometer-icp-oes.html","name":"Induktiv gekoppeltes Plasma - Optisches Emissions-Spektrometer (ICP-OES)"},{"uid":299,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/inertialmesseinheiten-imu.html","name":"Inertialmesseinheiten (IMU)"},{"uid":287,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/infrarotspektrometer-grips.html","name":"Infrarotspektrometer (GRIPS)"},{"uid":257,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/ionenchromatograph-ic.html","name":"Ionenchromatograph (IC)"},{"uid":417,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/ir-leistungslaser-zum-photonischen-sintern.html","name":"IR-Leistungslaser zum Photonischen Sintern"},{"uid":511,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/isokinetik.html","name":"Isokinetik"},{"uid":199,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/isolationsmessgeraet-bis-30-kv-nennspannung.html","name":"Isolationsmessger\u00e4t bis 30 kV Nennspannung"},{"uid":191,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/kabeldiagnosegeraet-vlf-und-tan-delta-verlustfaktor.html","name":"Kabeldiagnoseger\u00e4t (VLF und tan-Delta Verlustfaktor)"},{"uid":407,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/keyence-vk-x-100-series.html","name":"Keyence VK X-100 series"},{"uid":525,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/klavier.html","name":"Klavier"},{"uid":147,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/klimakammer.html","name":"Klimakammer"},{"uid":233,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/klimastation.html","name":"Klimastation"},{"uid":255,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/kohlenstoff-stickstoff-analysator-cn-analyzer.html","name":"Kohlenstoff-Stickstoff-Analysator (C\/N-Analyzer)"},{"uid":33,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/kondensationskern-partikelzaehler.html","name":"Kondensationskern-Partikelz\u00e4hler"},{"uid":137,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/kontaktwinkelmessgeraet.html","name":"Kontaktwinkelmessger\u00e4t"},{"uid":453,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/kontaktwinkelmessplatz.html","name":"Kontaktwinkelmessplatz"},{"uid":473,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/kontaktwinkelmessplatz-1.html","name":"Kontaktwinkelmessplatz"},{"uid":393,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/labor-dlp-stereolithografiedrucker.html","name":"Labor DLP Stereolithografiedrucker"},{"uid":399,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/labor-fdm-drucker-fuer-format-600-x-450-x-60-mm.html","name":"Labor FDM-Drucker f\u00fcr Format 600 x 450 x 60 mm"},{"uid":209,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/ladesaeulen-fuer-elektrofahrzeuge.html","name":"Lades\u00e4ulen f\u00fcr Elektrofahrzeuge"},{"uid":10,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/laermmessgeraet-personen-schallexposimeter.html","name":"L\u00e4rmmessger\u00e4t Personen-Schallexposimeter"},{"uid":333,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/digitallabor-fuer-modellbau-und-fertigungstechniken.html","name":"Lasercutter"},{"uid":295,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/laserscanner.html","name":"Laserscanner"},{"uid":113,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/led-stroboskop-1.html","name":"LED-Stroboskop"},{"uid":305,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/lichtfeldkamera.html","name":"Light Field Camera"},{"uid":491,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/lopap-long-path-absorption-photometer-messverfahren.html","name":"LOPAP (Long-Path-Absorption Photometer)-Messverfahren"},{"uid":567,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/ls-dyna.html","name":"LS-DYNA"},{"uid":367,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/luxmeter-spektrometer.html","name":"Luxmeter Spektrometer"},{"uid":441,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/maskenbelichter.html","name":"Maskenbelichter"},{"uid":461,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/maskenbelichter-1.html","name":"Maskenbelichter"},{"uid":119,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/massenspektrometer.html","name":"Massenspektrometer"},{"uid":243,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/massenspektrometer-quad-tquad-qit-tof-sektor.html","name":"Massenspektrometer (Quad, TQuad, QIT, TOF, Sektor)"},{"uid":499,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/massenspektrometrie.html","name":"Massenspektrometrie"},{"uid":123,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/masseverlustkalorimeter.html","name":"Masseverlustkalorimeter"},{"uid":425,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/materialbibliothek.html","name":"Materialbibliothek"},{"uid":481,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/maxqda.html","name":"MAXQDA"},{"uid":223,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/medienlabor.html","name":"Medienlabor"},{"uid":369,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/mehrkomponenten-kraftmessplatte-kraftmessplattform.html","name":"Mehrkomponenten-Kraftmessplatte, Kraftmessplattform"},{"uid":59,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/membran-pruefstaende-wasser-abwasserbehandlung.html","name":"Membran-Pr\u00fcfst\u00e4nde Wasser-\/Abwasserbehandlung"},{"uid":363,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/meqsico-numerische-fem-simulation-von-betriebsmitteln-der-hochspannungstechnik.html","name":"MEQSICO (Numerische FEM-Simulation von Betriebsmitteln der Hochspannungstechnik)"},{"uid":503,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/messung-von-gewebespannung.html","name":"Messung von Gewebespannung"},{"uid":77,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/metallografische-praeparationstechnik.html","name":"Metallografische Pr\u00e4parationstechnik"},{"uid":377,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/microsoft-hololens.html","name":"Microsoft HoloLens"},{"uid":197,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/mikroohmmeter-bis-605-a-dc.html","name":"Mikroohmmeter bis 605 A (DC)"},{"uid":267,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/mikrowelle.html","name":"Mikrowelle"},{"uid":561,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/mobcal-he-n2.html","name":"MOBCAL (He, N2)"},{"uid":31,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/mobilitaetsanalysatoren.html","name":"Mobilit\u00e4tsanalysatoren"},{"uid":47,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/moersermuehle.html","name":"M\u00f6rserm\u00fchle"},{"uid":543,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/motorenpruefstand-bis-400kw.html","name":"Motorenpr\u00fcfstand bis 400kW"},{"uid":269,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/muffelofen.html","name":"Muffelofen"},{"uid":547,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/netzanaylsegeraete.html","name":"Netzanaylseger\u00e4te"},{"uid":495,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/nmr-spektroskopie.html","name":"NMR-Spektroskopie"},{"uid":375,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/oculus-rift.html","name":"Oculus Rift"},{"uid":73,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/optische-funkenspektrometrie-zur-elementanalyse.html","name":"Optische Funkenspektrometrie zur Elementanalyse"},{"uid":29,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/optische-partikelzaehler-und-groessenanalysatoren.html","name":"Optische Partikelz\u00e4hler und -gr\u00f6\u00dfenanalysatoren"},{"uid":521,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/optischer-spektrumanalsator.html","name":"Optischer Spektrumanalsator"},{"uid":165,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/oszilloskop.html","name":"Oszilloskop"},{"uid":487,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/parallele-supercomputer.html","name":"Parallele Supercomputer"},{"uid":337,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/parallelrechner-in-verschiedenen-groessen.html","name":"Parallelrechner in verschiedenen Gr\u00f6\u00dfen"},{"uid":99,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/partikelanalysator-laser-diffraktometrie-1.html","name":"Partikelanalysator (Laser-Diffraktometrie)"},{"uid":37,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/partikelgroessenanalyse-mittels-dynamischer-lichtstreuung.html","name":"Partikelgr\u00f6\u00dfenanalyse mittels dynamischer Lichtstreuung"},{"uid":35,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/partikelgroessenanalyse-mittels-statischer-lichtstreuung.html","name":"Partikelgr\u00f6\u00dfenanalyse mittels statischer Lichtstreuung"},{"uid":555,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/photovoltaik-simulator.html","name":"Photovoltaik Simulator"},{"uid":559,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/prallverschleisspruefstand.html","name":"Prallverschlei\u00dfpr\u00fcfstand"},{"uid":449,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/profilometer.html","name":"Profilometer"},{"uid":469,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/profilometer-1.html","name":"Profilometer"},{"uid":427,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/pvd-kammer.html","name":"PVD-Kammer"},{"uid":249,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/quecksilber-atomabsorptions-spektrometer-aas.html","name":"Quecksilber Atomabsorptions-Spektrometer (AAS)"},{"uid":251,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/quecksilber-kaltdampf-atomfluoreszenz-spektrometer-cv-afs.html","name":"Quecksilber Kaltdampf-Atomfluoreszenz-Spektrometer (CV-AFS)"},{"uid":413,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rd-labor-inkjet-drucker-fuji-dimatix.html","name":"R&D Labor InkJet Drucker Fuji Dimatix"},{"uid":389,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/randwinkelprojektor-data-physics-oca.html","name":"Randwinkelprojektor Data Physics OCA"},{"uid":533,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/raspberry-pi.html","name":"Raspberry Pi"},{"uid":63,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rasterelektronenmikroskop-rem.html","name":"Rasterelektronenmikroskop"},{"uid":437,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rasterelektronenmikroskop.html","name":"Rasterelektronenmikroskop"},{"uid":457,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rasterelektronenmikroskop-1.html","name":"Rasterelektronenmikroskop"},{"uid":429,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rasterkraftmikroskop.html","name":"Rasterkraftmikroskop"},{"uid":439,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rasterkraftmikroskop-1.html","name":"Rasterkraftmikroskop"},{"uid":459,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rasterkraftmikroskop-2.html","name":"Rasterkraftmikroskop"},{"uid":365,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rastersondenmikroskop.html","name":"Rastersondenmikroskop"},{"uid":231,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/raumklimaanalysator.html","name":"Raumklimaanalysator"},{"uid":335,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rechenzentrum-pleiades.html","name":"Rechenzentrum \"Pleiades\""},{"uid":133,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rheometer.html","name":"Rheometer"},{"uid":409,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/roentgen-computertomograph-300-nm-aufloesung.html","name":"R\u00f6ntgen-Computertomograph (300 nm Aufl\u00f6sung)"},{"uid":319,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/roentgencomputertomographie-ct-einrichtung-fuer-transmissions-und-beugungsmessungen.html","name":"R\u00f6ntgen-CT-Einrichtung f\u00fcr Transmissions- und Beugungsmessungen"},{"uid":317,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/roentgenbeugungs-einrichtung-zur-zerstoerungsfreien-untersuchung-ausgedehnter-objekte.html","name":"R\u00f6ntgenbeugungs-Einrichtung zur zerst\u00f6rungsfreien Untersuchung ausgedehnter Objekte"},{"uid":69,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/roentgendiffraktion.html","name":"R\u00f6ntgendiffraktion"},{"uid":149,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/roentgentomograph.html","name":"R\u00f6ntgentomographie"},{"uid":395,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rostock-max-fdm-drucker.html","name":"Rostock MAX FDM-Drucker"},{"uid":535,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/rover-indoor-ueberwachungsroboter.html","name":"Rover - indoor \u00dcberwachungsroboter"},{"uid":237,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/schallmesstechnik.html","name":"Schallmesstechnik"},{"uid":8,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/schallpegelmessgeraet.html","name":"Schallpegelmessger\u00e4t"},{"uid":205,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/schaltzeitmessgeraet.html","name":"Schaltzeitmessger\u00e4t"},{"uid":139,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/schaumbox.html","name":"Schaumbox"},{"uid":49,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/schuettelmischer.html","name":"Sch\u00fcttelmischer"},{"uid":75,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/schutzgas-und-vakuumwaermebehandlung.html","name":"Schutzgas- und Vakuumw\u00e4rmebehandlung"},{"uid":3,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/schwingungsmessgeraet.html","name":"Schwingungsmessger\u00e4t"},{"uid":391,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/sense-2-3d-handscanner.html","name":"Sense 2 3D-Handscanner"},{"uid":289,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/sf6-handlinggeraet-und-analyzer.html","name":"SF6-Handlingger\u00e4t und -analyzer"},{"uid":357,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/sim4life-elektromagnetische-umweltvertraeglichkeitsanalysen.html","name":"SIM4LIFE (Elektromagnetische Umweltvertr\u00e4glichkeitsanalysen)"},{"uid":211,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/smart-grid-labor.html","name":"Smart Grid Labor"},{"uid":551,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/smd-bestueckung.html","name":"SMD Best\u00fcckung"},{"uid":539,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/spannungsversorgung-drehstrom-690v-25mw.html","name":"Spannungsversorgung 690V Drehstrom 2,5 MW"},{"uid":537,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/spannungsversorgung-drehstrom-400v-25mw.html","name":"Spannungsversorgung Drehstrom 400V 2,5 MW"},{"uid":259,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/spektralphotometer.html","name":"Spektralphotometer"},{"uid":201,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/spektrumanalysator.html","name":"Spektrumanalysator"},{"uid":387,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/spiroergometrie.html","name":"Spiroergometrie"},{"uid":509,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/stationaere-und-mobile-dreidimensionale-kraftmessplatten.html","name":"Station\u00e4re und mobile dreidimensionale Kraftmessplatten"},{"uid":55,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/staubungsmessgeraete.html","name":"Staubungsmessger\u00e4te"},{"uid":293,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/stereo-camera.html","name":"Stereo Camera"},{"uid":347,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/tablet-sony-xperia-z2.html","name":"Tablet Sony Xperia Z2"},{"uid":493,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/teilchendetektoren.html","name":"Teilchendetektoren"},{"uid":193,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/teilentladungsmessgeraete-konventionell-akustisch-uhf-tev-hfct.html","name":"Teilentladungsmessger\u00e4te (konventionell, akustisch, UHF, TEV, HFCT)"},{"uid":105,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/temperaturfuehler-1.html","name":"Temperaturf\u00fchler"},{"uid":135,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/tensiometer.html","name":"Tensiometer"},{"uid":301,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/thermo-kamera.html","name":"Thermo-Kamera"},{"uid":229,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/thermografie.html","name":"Thermografie"},{"uid":117,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/thermogravimeter-mit-dynamischer-differenzkalorimetrie.html","name":"Thermogravimetrie"},{"uid":291,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/tiefenbildsensoren-time-of-flight-tof-sensors.html","name":"Tiefenbildsensoren \/ Time of Flight (TOF) sensors"},{"uid":129,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/toc-analysator.html","name":"TOC-Analysator"},{"uid":557,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/tribometer.html","name":"Tribometer"},{"uid":265,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/trockenschraenke.html","name":"Trockenschr\u00e4nke"},{"uid":1,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/ultimaker-3d-drucker.html","name":"Ultimaker 3D Drucker"},{"uid":107,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/umluft-trockenschrank-1.html","name":"Umluft-Trockenschrank"},{"uid":549,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/frequenzumrichter-motorumrichter.html","name":"Umrichter"},{"uid":415,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/uv-labor-trockner.html","name":"UV-Labor-Trockner"},{"uid":411,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/uv-offset-bogendruckmaschine.html","name":"UV-Offset Bogendruckmaschine"},{"uid":475,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/uv-tauchlampenreaktor.html","name":"UV-Tauchlampenreaktor"},{"uid":221,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/uv-vis-ir-laser.html","name":"UV, VIS, IR Laser"},{"uid":131,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/uvvis-photometer.html","name":"UV\/VIS-Photometer"},{"uid":219,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/vakuum-apparaturen.html","name":"Vakuum Apparaturen"},{"uid":125,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/vci-verbrennungsofen.html","name":"VCI-Verbrennungsofen"},{"uid":203,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/vektor-netzwerk-analysator.html","name":"Vektor-Netzwerk-Analysator"},{"uid":331,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/verkehrszaehlgeraete.html","name":"Verkehrsz\u00e4hlger\u00e4te"},{"uid":2,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/vibrationsmessgeraet.html","name":"Vibrationsmessger\u00e4t"},{"uid":4,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/vibrometer.html","name":"Vibrometer"},{"uid":515,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/videokamera.html","name":"Videokamera"},{"uid":517,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/videokamera-1.html","name":"Videokamera"},{"uid":225,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/virtual-reality.html","name":"Virtual Reality"},{"uid":65,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/vollautomatische-mikro-und-makrohaertepruefung.html","name":"Vollautomatische Mikro- und Makroh\u00e4rtepr\u00fcfung"},{"uid":527,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/vuv-uv-vis-spektrometer.html","name":"VUV, UV-VIS Spektrometer"},{"uid":217,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/vuv-uv-vis-ir-photometer.html","name":"VUV, UV-VIS, IR Photometer"},{"uid":513,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/waermebildkamera-3.html","name":"W\u00e4rmebildkamera"},{"uid":207,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/waermebildkamera-2.html","name":"W\u00e4rmebildkamera"},{"uid":61,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/wasseranalytik.html","name":"Wasseranalytik"},{"uid":339,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/wasserbaulabor-hydraulische-versuche.html","name":"Wasserbaulabor - Hydraulische Versuche"},{"uid":185,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/wechselspannungstransformator-300-kv.html","name":"Wechselspannungstransformator 300 kV"},{"uid":111,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/wegmesser-laser-optisch-1.html","name":"Wegmesser (laser-optisch)"},{"uid":447,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/weisslichtinterferometer.html","name":"Wei\u00dflichtinterferometer"},{"uid":467,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/weisslichtinterferometer-1.html","name":"Wei\u00dflichtinterferometer"},{"uid":445,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/wellenleiterspektroskopie.html","name":"Wellenleiterspektroskopie"},{"uid":465,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/wellenleiterspektroskopie-1.html","name":"Wellenleiterspektroskopie"},{"uid":443,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/winkelaufgeloeste-spektroskopie.html","name":"Winkelaufgel\u00f6ste Spektroskopie"},{"uid":463,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/winkelaufgeloeste-spektroskopie-1.html","name":"Winkelaufgel\u00f6ste Spektroskopie"},{"uid":501,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/wirbelsaeulenvermessung.html","name":"Wirbels\u00e4ulenvermessung"},{"uid":261,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/zentrifuge.html","name":"Zentrifuge"},{"uid":79,"url":"http:\/\/\/en\/scientistdatabase\/devices\/show\/device\/zug-druck-und-torsionspruefung.html","name":"Zug-, Druck- und Torsionspr\u00fcfung"}],"researchFocus":[{"uid":237,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/3-d-szenen-und-objekterfassung.html","name":"3-D Szenenerfassung"},{"uid":699,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/3d-szenenerfassung.html","name":"3D Szenenerfassung"},{"uid":701,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/3d-szenenrekonstruktion.html","name":"3D Szenenrekonstruktion"},{"uid":223,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/3d-druck-additive-fertigung.html","name":"3D-Druck & Additive Fertigung"},{"uid":103,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/affektkommunikation.html","name":"Affektkommunikation"},{"uid":1033,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/algen-als-symbiosen-in-meeresnacktschnecken.html","name":"Algen als Symbiosen in Meeresnacktschnecken"},{"uid":1661,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/algorithmische-algebra.html","name":"Algorithmische Algebra"},{"uid":387,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/alterung-von-netzbetriebsmitteln.html","name":"Alterung von Netzbetriebsmitteln"},{"uid":573,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/anforderungsmanagement.html","name":"Anforderungsmanagement"},{"uid":603,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/angewandte-linguistik.html","name":"Angewandte Linguistik"},{"uid":71,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/anreizsysteme.html","name":"Anreizsysteme"},{"uid":1495,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/antike-geschlechtergeschichte.html","name":"Antike Geschlechtergeschichte"},{"uid":1493,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/antike-koerpergeschichte.html","name":"Antike K\u00f6rpergeschichte"},{"uid":1503,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/antike-medizingeschichte.html","name":"Antike Medizingeschichte"},{"uid":135,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/antikenrezeption.html","name":"Antikenrezeption"},{"uid":311,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/arbeit-alter-gesundheit-und-erwerbsteilhabe.html","name":"Arbeit, Alter, Gesundheit und Erwerbsteilhabe"},{"uid":1335,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/arbeiten-40.html","name":"Arbeiten 4.0"},{"uid":1117,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/arbeitsphysiologie.html","name":"Arbeitsphysiologie"},{"uid":1407,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/arbeitspsychologie.html","name":"Arbeitspsychologie"},{"uid":12,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/arbeitsschutz.html","name":"Arbeitsschutz"},{"uid":1123,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/arbeitsstressforschung.html","name":"Arbeitsstressforschung"},{"uid":20,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/arbeitssystembeschreibungen.html","name":"Arbeitssystembeschreibungen"},{"uid":1113,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/arbeitswissenschaft.html","name":"Arbeitswissenschaft"},{"uid":425,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/architectural-geometry.html","name":"Architectural Geometry"},{"uid":1698,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/architekturdiskurs.html","name":"Architekturdiskurs"},{"uid":1702,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/architekturgeschichte-des-20-jahrhunderts.html","name":"Architekturgeschichte des 20. Jahrhunderts"},{"uid":1714,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/archive.html","name":"Archive"},{"uid":367,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/assetmanagement.html","name":"Assetmanagement"},{"uid":725,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/assistenzsysteme-fuer-senioren-und-mobilitaetseingeschraenkte-personen.html","name":"Assistenzsysteme f\u00fcr Senioren und mobilit\u00e4tseingeschr\u00e4nkte Personen"},{"uid":1297,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/astroteilchenphysik.html","name":"Astroteilchenphysik"},{"uid":1277,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/atmosphaerenchemie.html","name":"Atmosph\u00e4renchemie"},{"uid":1393,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/aufwachsen-und-soziale-ungleichheit.html","name":"Aufwachsen und soziale Ungleichheit"},{"uid":1331,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/augmented-reality.html","name":"Augmented Reality"},{"uid":1133,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/auktionen.html","name":"Auktionen"},{"uid":751,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/automatisierte-zielnetzplanung.html","name":"Automatisierte Netzplanung"},{"uid":727,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/autonomes-fahren.html","name":"Autonomous Driving"},{"uid":123,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/barockforschung.html","name":"Barockforschung"},{"uid":905,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/barrierefreiheit.html","name":"Barrierefreiheit"},{"uid":335,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/baubetrieb-und-bauwirtschaft.html","name":"Baubetrieb und Bauwirtschaft"},{"uid":1667,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/baudenkmalpflege.html","name":"Baudenkmalpflege"},{"uid":1105,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bauplanungsrecht-formelle-und-informelle-instrumente.html","name":"Bauplanungsrecht (formelle und informelle Instrumente)"},{"uid":1071,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bedrucken-dreidimensionaler-oberflaechen.html","name":"Bedrucken dreidimensionaler Oberfl\u00e4chen"},{"uid":1595,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/berufsbildungsforschung.html","name":"Berufsbildungsforschung"},{"uid":631,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/berufsorientierung-fuer-naturwissenschaftlich-technische-berufe.html","name":"Berufsorientierung f\u00fcr naturwissenschaftlich-technische Berufe"},{"uid":1135,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/beschaffungsauktionen.html","name":"Beschaffungsauktionen"},{"uid":185,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/betriebliche-kompetenzentwicklung.html","name":"Betriebliche Kompetenzentwicklung"},{"uid":211,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/beurteilung-und-foederung-der-sprechleistung.html","name":"Beurteilung und F\u00f6derung der Sprechleistung"},{"uid":1649,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bevoelkerungsschutz.html","name":"Bev\u00f6lkerungsschutz"},{"uid":1327,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bewegungs-und-trainingswissenschaft.html","name":"Bewegungs- und Trainingswissenschaft"},{"uid":75,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bewertung-flexibler-investitionen.html","name":"Bewertung flexibler Investitionen"},{"uid":1641,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/beyond-the-standard-model-bsm.html","name":"Beyond the Standard Model (BSM)"},{"uid":461,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bibeldidaktik-1.html","name":"Bibeldidaktik"},{"uid":291,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bibliometrie.html","name":"Bibliometrie"},{"uid":347,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/big-data.html","name":"Big Data"},{"uid":641,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bild-text-beziehungen-vor-allem-emblematik-und-mnemonik.html","name":"Bild-Text-Beziehungen, vor allem Emblematik und Mnemonik"},{"uid":215,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bilderbuecher-im-englischunterricht.html","name":"Bilderb\u00fccher im Englischunterricht"},{"uid":475,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bilderbuecher-im-religionsunterricht.html","name":"Bilderb\u00fccher im Religionsunterricht"},{"uid":115,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildtheologie.html","name":"Bildtheologie"},{"uid":977,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildung.html","name":"Bildung"},{"uid":1710,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildung-fuer-nachhaltige-entwicklung.html","name":"Bildung f\u00fcr nachhaltige Entwicklung"},{"uid":269,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildungsbezogene-forschung-zum-umgang-mit-dem-nationalsozialismus.html","name":"Bildungsbezogene Forschung zum Umgang mit dem Nationalsozialismus"},{"uid":195,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildungsdeprivation.html","name":"Bildungsdeprivation"},{"uid":1565,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildungsertraege.html","name":"Bildungsertr\u00e4ge"},{"uid":1659,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildungsfinanzierung.html","name":"Bildungsfinanzierung"},{"uid":1599,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildungspolitik.html","name":"Bildungspolitik"},{"uid":1605,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildungspolitik-1.html","name":"Bildungspolitik"},{"uid":481,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildungssprache-sprache-im-fachunterricht.html","name":"Bildungssprache, Sprache im Fachunterricht"},{"uid":197,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildungssysteme.html","name":"Bildungssysteme"},{"uid":193,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildungsungleichheiten.html","name":"Bildungsungleichheiten"},{"uid":683,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bildverarbeitung.html","name":"Bildverarbeitung"},{"uid":1045,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bilingualer-unterricht-biologie.html","name":"Bilingualer Unterricht Biologie"},{"uid":1543,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bilingualer-unterricht-chemie.html","name":"Bilingualer Unterricht Chemie"},{"uid":203,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bilinguales-lehren-und-lernen.html","name":"Bilinguales Lehren und Lernen"},{"uid":973,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bim.html","name":"BIM"},{"uid":521,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/biogeochemie.html","name":"Biogeochemie"},{"uid":1017,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/biographieforschung.html","name":"Biographieforschung"},{"uid":305,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/biomechanics.html","name":"Biomechanics"},{"uid":1477,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/blickgeschichte.html","name":"Blickgeschichte"},{"uid":747,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/blindleistungsmanagement.html","name":"Blindleistungsmanagement"},{"uid":1270,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/blockcopolymere.html","name":"Blockcopolymere"},{"uid":519,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bodenkunde.html","name":"Bodenkunde"},{"uid":525,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bodenmikrobiologie.html","name":"Bodenmikrobiologie"},{"uid":527,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bodenoekologie.html","name":"Boden\u00f6kologie"},{"uid":531,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/bodenschutz.html","name":"Bodenschutz"},{"uid":777,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/brand-und-explosionsschutz.html","name":"Brand- und Explosionsschutz"},{"uid":161,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/brand-und-loeschchemie.html","name":"Brand- und L\u00f6schchemie"},{"uid":913,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/branddynamik.html","name":"Branddynamik"},{"uid":661,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/breitband-powerline-kommunikation.html","name":"Breitband-Powerline-Kommunikation"},{"uid":1475,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/buchmalerei.html","name":"Buchmalerei"},{"uid":339,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/building-information-modeling.html","name":"Building Information Modeling"},{"uid":1107,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/buergerbeteiligungsprozesse.html","name":"B\u00fcrgerbeteiligung"},{"uid":1401,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/burnout.html","name":"Burnout"},{"uid":171,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/carsharing.html","name":"Carsharing"},{"uid":875,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/chemie-der-atmosphaere.html","name":"Chemie der Atmosph\u00e4re"},{"uid":1303,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/cherenkov-detektoren.html","name":"Cherenkov-Detektoren"},{"uid":1025,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/chloroplastengenom-analysen.html","name":"Chloroplastengenom-Analysen"},{"uid":1031,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/ciliaten-als-biologischer-filter-in-klaeranlagen.html","name":"Ciliaten als biologischer Filter in Kl\u00e4ranlagen"},{"uid":1019,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/comicforschung.html","name":"Comicforschung"},{"uid":665,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/compuational-physics.html","name":"Compuational Physics"},{"uid":1533,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/computational-chemistry.html","name":"Computational Chemistry"},{"uid":663,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/computational-engineering.html","name":"Computational Engineering"},{"uid":657,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/computational-finance.html","name":"Computational Finance"},{"uid":423,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/computational-structure-design.html","name":"Computational Structure Design"},{"uid":487,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/coporate-governance.html","name":"Coporate Governance"},{"uid":483,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/corporate-finance.html","name":"Corporate Finance"},{"uid":769,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/crashberechnung.html","name":"Crashberechnung"},{"uid":1197,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/curriculare-innovationsforschung.html","name":"Curriculare Innovationsforschung"},{"uid":1229,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/curriculumentwicklung.html","name":"Curriculumentwicklung"},{"uid":647,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/cyber-physical-systems.html","name":"Cyber Physical Systems"},{"uid":1413,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/deep-learning-1.html","name":"Deep Learning"},{"uid":707,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/maschinelles-lernen.html","name":"Maschinelles Lernen"},{"uid":1137,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/dehnbare-elektronik.html","name":"dehnbare Elektronik"},{"uid":1363,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/demand-response.html","name":"Demand Response"},{"uid":99,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/demographischer-wandel.html","name":"Demographischer Wandel"},{"uid":1041,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/der-naturwissenschaftliche-erkenntnisweg-als-weg-zur-sachlichkeit-in-der-lehrerausbildung-in-biologi.html","name":"Der naturwissenschaftliche Erkenntnisweg als Weg zur Sachlichkeit in der Lehrerausbildung in Biologie"},{"uid":6,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/design-thinking.html","name":"Design Thinking"},{"uid":543,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/designforschung.html","name":"Designforschung"},{"uid":109,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/designrhetorik.html","name":"Designrhetorik"},{"uid":1617,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/deutsche-geschichte.html","name":"Deutsche Geschichte"},{"uid":785,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/dezentrale-energieversorgungskonzepte.html","name":"Dezentrale Energieversorgungskonzepte"},{"uid":1235,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/didaktik-der-astronomie.html","name":"Didaktik der Astronomie"},{"uid":1491,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/didaktik-der-populaeren-musik.html","name":"Didaktik der Popul\u00e4ren Musik"},{"uid":1694,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/didaktik-des-plastischen-formens.html","name":"Didaktik des plastischen Formens"},{"uid":1693,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/didaktik-des-unterrichtsfaches-erziehungswissenschaft.html","name":"Didaktik des Unterrichtsfaches Erziehungswissenschaft"},{"uid":1225,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/didaktik-und-philosophie-der-modernen-physik.html","name":"Didaktik und Philosophie der modernen Physik"},{"uid":1233,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/didaktik-und-philosophie-der-modernen-physik-1.html","name":"Didaktik und Philosophie der modernen Physik"},{"uid":1199,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/didaktisch-integrativer-chemieunterricht.html","name":"Didaktisch Integrativer Chemieunterricht"},{"uid":1153,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/dielektrische-plasmonische-und-hybride-wellenleiter.html","name":"Dielektrische, plasmonische und hybride Wellenleiter"},{"uid":1177,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/dielektrische-plasmonische-und-hybride-wellenleiter-1.html","name":"Dielektrische, plasmonische und hybride Wellenleiter"},{"uid":411,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/diffusion-von-innovation.html","name":"Diffusion von Innovation"},{"uid":609,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digital-history.html","name":"Digital History"},{"uid":607,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digital-humanities.html","name":"Digital Humanities"},{"uid":233,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digitale-bildung.html","name":"Digitale Bildung"},{"uid":893,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digitale-entwurfs-und-darstellungstechniken.html","name":"Digitale Darstellungstechniken"},{"uid":687,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digitale-filter.html","name":"Digitale Filter"},{"uid":559,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digitale-medien-in-der-bildung.html","name":"Digitale Medien in der Bildung"},{"uid":681,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digitale-signalverarbeitung.html","name":"Digitale Signalverarbeitung"},{"uid":645,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digitale-transformation.html","name":"Digitale Transformation"},{"uid":1712,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digitales-kulturerbe.html","name":"Digitales Kulturerbe"},{"uid":1333,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digitalisierung.html","name":"Digitalisierung"},{"uid":1529,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/digitalisierung-1.html","name":"Digitalisierung"},{"uid":1359,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/diplomatik.html","name":"Diplomatik"},{"uid":989,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/diskrete-optimierung.html","name":"Diskrete Optimierung"},{"uid":263,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/diskriminierungsforschung.html","name":"Diskriminierungsforschung"},{"uid":1075,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/druckverfahrenstechnik.html","name":"Druckverfahrenstechnik"},{"uid":1147,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/duennschichttechnologie.html","name":"D\u00fcnnschichttechnologie"},{"uid":1171,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/duennschichttechnologie-1.html","name":"D\u00fcnnschichttechnologie"},{"uid":355,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/dynamische-rekonfiguration.html","name":"Dynamische Rekonfiguration"},{"uid":1507,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/dystopie.html","name":"Dystopie"},{"uid":1597,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/e-learning.html","name":"E-Learning"},{"uid":343,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/echtzeitsysteme.html","name":"Echtzeitsysteme"},{"uid":549,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/editionsmodelle.html","name":"Editionsmodelle"},{"uid":437,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/editionswissenschaft.html","name":"Editionswissenschaft"},{"uid":183,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/edmund-polak-edition-german-polish.html","name":"Edmund Polak-Edition (German-Polish)"},{"uid":1021,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/eigenwertalgorithmen.html","name":"Eigenwertalgorithmen"},{"uid":341,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/eingebettete-systeme.html","name":"Eingebettete Systeme"},{"uid":273,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/einstellungen.html","name":"Einstellungen"},{"uid":199,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/einstellungserfassung-von-lehramtsstudierenden.html","name":"Einstellungserfassung von Lehramtsstudierenden"},{"uid":629,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/eisen-und-stahl.html","name":"Eisen und Stahl"},{"uid":1449,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/elektrische-maschinen.html","name":"Elektrische Maschinen"},{"uid":1001,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/elektromagnetische-felder.html","name":"Elektromagnetische Felder"},{"uid":1003,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/elektromagnetische-feldtheorie.html","name":"Elektromagnetische Feldtheorie"},{"uid":991,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/elektromagnetische-vertraeglichkeit.html","name":"Elektromagnetische Vertr\u00e4glichkeit"},{"uid":993,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/elektromagnetische-vertraeglichkeit-unter-umweltaspekten.html","name":"Elektromagnetische Vertr\u00e4glichkeit unter Umweltaspekten"},{"uid":947,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/elektromobilitaet.html","name":"Elektromobilit\u00e4t"},{"uid":145,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/elektrotechnik.html","name":"Elektrotechnik"},{"uid":1397,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/elementarteilchenphysik.html","name":"Elementarteilchenphysik"},{"uid":753,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/emotionale-intelligenz.html","name":"Emotionale Intelligenz"},{"uid":869,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/empirische-bildungs-schulsportforschung.html","name":"Empirische Bildungs-\/Schulsportforschung (insbes. Differenzstudien\/\"SpuSS\")"},{"uid":259,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/empirische-forschungsmethoden.html","name":"Empirische Forschungsmethoden"},{"uid":255,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/employee-volunteering.html","name":"Employee Volunteering"},{"uid":1665,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/endliche-einfache-gruppen.html","name":"Endliche einfache Gruppen"},{"uid":313,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/energiebedarf-von-nichtwohngebaeuden.html","name":"Energiebedarf von Nichtwohngeb\u00e4uden"},{"uid":385,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/energieeffizienz.html","name":"Energieeffizienz"},{"uid":459,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/energiemonitoring.html","name":"Energiemonitoring"},{"uid":949,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/energiespeichersysteme.html","name":"Energiespeichersysteme"},{"uid":435,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/energieverbrauch-von-nichtwohngebaeuden.html","name":"Energieverbrauch von Nichtwohngeb\u00e4uden"},{"uid":359,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/energieversorgung.html","name":"Energieversorgung"},{"uid":951,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/energieclusterbildung.html","name":"Energy cluster formation"},{"uid":165,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/enge-beziehungen.html","name":"Enge Beziehungen"},{"uid":1043,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/entwicklung-und-evaluation-innovativer-unterrichtskonzepte.html","name":"Entwicklung und Evaluation innovativer Unterrichtskonzepte"},{"uid":1696,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/entwicklungshilfediskurs.html","name":"Entwicklungshilfediskurs"},{"uid":1700,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/entwicklungshilfediskurs-1.html","name":"Entwicklungshilfediskurs"},{"uid":677,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/epistemological-status-of-simulation-methods-in-high-energy-physics.html","name":"Epistemological status of simulation methods in high energy physics"},{"uid":1115,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/ergonomie.html","name":"Ergonomie"},{"uid":1039,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/erstellung-von-messinstrumenten-zur-expermentierfaehigkeit-faehigkeitsselbstkonzept.html","name":"Erstellung von Messinstrumenten zur Expermentierf\u00e4higkeit, F\u00e4higkeitsselbstkonzept"},{"uid":417,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/erzaehlforschung.html","name":"Erz\u00e4hlforschung"},{"uid":261,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/erziehungswissenschaftliche-geschlechterforschung.html","name":"Erziehungswissenschaftliche Geschlechterforschung"},{"uid":1591,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/eu-and-china.html","name":"EU and China"},{"uid":137,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/europaeische-bildung-und-kultur.html","name":"Europ\u00e4ische Bildung und Kultur"},{"uid":825,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/exakt-loesbare-modelle.html","name":"Exakt-l\u00f6sbare Modelle"},{"uid":1567,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/experimentalunterricht.html","name":"Experimentalunterricht"},{"uid":153,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/experimentelle-stroemungsmechanik.html","name":"Experimentelle Str\u00f6mungsmechanik"},{"uid":1203,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/experimentierboxen-fuer-den-chemieunterricht.html","name":"Experimentierboxen f\u00fcr den Chemieunterricht"},{"uid":1037,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/experimentierfaehigkeit-von-lernenden.html","name":"Experimentierf\u00e4higkeit von Lernenden"},{"uid":1219,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/facebook.html","name":"Facebook"},{"uid":1603,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/fachdidaktik.html","name":"Fachdidaktik"},{"uid":1067,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/farbraumerweiterungen.html","name":"Farbraumerweiterungen"},{"uid":1073,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/farbrichtiges-scannen-interreflektierender-oberflaechen.html","name":"Farbrichtiges Scannen interreflektierender Oberfl\u00e4chen"},{"uid":1669,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/farbstrategien-in-der-architektur.html","name":"Farbstrategien in der Architektur"},{"uid":779,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/faserverbundstrukturen.html","name":"Faserverbundstrukturen"},{"uid":357,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/feedback.html","name":"Feedback"},{"uid":1011,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/fehler-und-zuverlaessigkeitsuntersuchungen.html","name":"Fehler- und Zuverl\u00e4ssigkeitsuntersuchungen"},{"uid":61,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/fertigungstechnik.html","name":"Fertigungstechnik"},{"uid":413,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/feuerwehrwissenschaften.html","name":"Feuerwehrwissenschaften"},{"uid":771,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/finite-elemente-berechnung.html","name":"Finite Elemente Berechnung"},{"uid":619,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/fitness.html","name":"Fitness"},{"uid":1213,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/flaechensparen.html","name":"Fl\u00e4chensparen"},{"uid":77,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/flexibilitaet.html","name":"Flexibilit\u00e4t"},{"uid":829,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/flexibilitaet-im-verteilungsnetz.html","name":"Flexibilit\u00e4t im Verteilungsnetz"},{"uid":883,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/floating-car-data.html","name":"Floating Car Data"},{"uid":931,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/flussgebietsmanagement.html","name":"Flussgebietsmanagement"},{"uid":1519,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/fluessigkeitsstuetzung-von-erdwaenden.html","name":"Fl\u00fcssigkeitsst\u00fctzung von Erdw\u00e4nden"},{"uid":921,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/flussueberschwemmungen.html","name":"Fluss\u00fcberschwemmungen"},{"uid":1589,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/foreign-direct-investment-innovation.html","name":"Foreign Direct Investment, Innovation"},{"uid":503,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/formale-semantik.html","name":"Formale Semantik"},{"uid":775,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/formoptimierung.html","name":"Formoptimierung"},{"uid":285,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/forschungsorganisationen.html","name":"Forschungsorganisationen"},{"uid":713,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/fpga-basierte-signalverarbeitung.html","name":"FPGA basierte Signalverarbeitung"},{"uid":1549,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/fruehkindliche-bildung.html","name":"Fr\u00fchkindliche Bildung"},{"uid":1611,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/fuehrung.html","name":"F\u00fchrung"},{"uid":309,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/funktionsdiagnostik.html","name":"Funktionsdiagnostik"},{"uid":1262,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/funktionspolymere.html","name":"Funktionspolymere"},{"uid":909,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/fussgaengerdynamik.html","name":"Fu\u00dfg\u00e4ngerdynamik"},{"uid":1547,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/game-design.html","name":"Game Design"},{"uid":867,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gas-distribution-1.html","name":"Gas distribution"},{"uid":659,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gasisolierte-hochspannungsschaltanlagen-gis.html","name":"Gasisolierte Hochspannungsschaltanlagen (GIS)"},{"uid":13,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gefaehrdungsbeurteilung.html","name":"Gef\u00e4hrdungsbeurteilung"},{"uid":19,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gefaehrdungsmodell.html","name":"Gef\u00e4hrdungsmodell"},{"uid":17,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gefahrstoffmanagement.html","name":"Gefahrstoffmanagement"},{"uid":16,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gefahrstoffrecht.html","name":"Gefahrstoffrecht"},{"uid":1515,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gegenwartsliteratur.html","name":"Gegenwartsliteratur"},{"uid":1623,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geistesgeschichte.html","name":"Geistesgeschichte"},{"uid":1539,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gender-und-mathematik.html","name":"Gender und Mathematik"},{"uid":1497,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gender-theorien-in-den-geschichtswissenschaften.html","name":"gender-Theorien in den Geschichtswissenschaften"},{"uid":585,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/generic-management-systems.html","name":"Generic Management Systems"},{"uid":583,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/generic-systems-engineering.html","name":"Generic Systems Engineering"},{"uid":1505,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/genres.html","name":"Genres"},{"uid":811,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geometrische-produktspezifikationen.html","name":"Geometrische Produktspezifikationen"},{"uid":749,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gesamtmodell-zur-optimalen-bewirtschaftung-elektrischer-verteilungsnetz.html","name":"Gesamtmodell zur optimalen Bewirtschaftung elektrischer Verteilungsnetz"},{"uid":1681,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geschichte-der-atmophaeren-und-klimawissenschaften.html","name":"Geschichte der Atmoph\u00e4ren- und Klimawissenschaften"},{"uid":1619,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geschichte-der-fruehen-neuzeit.html","name":"Geschichte der Fr\u00fchen Neuzeit"},{"uid":1625,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geschichte-der-usa.html","name":"Geschichte der USA"},{"uid":121,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geschichte-des-konfessionalismus-des-humanismus-und-der-europaeischen-bildung-und-kultur.html","name":"Geschichte des Konfessionalismus, des Humanismus und der europ\u00e4ischen Bildung und Kultur"},{"uid":1593,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geschichte-des-maler-und-lackiererhandwerks.html","name":"Geschichte des Maler und Lackiererhandwerks"},{"uid":1627,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geschichte-grossbritanniens.html","name":"Geschichte Gro\u00dfbritanniens"},{"uid":441,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geschichte-italiens.html","name":"Geschichte Italiens"},{"uid":1511,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geschichtsreflexionen-in-literatur-und-film.html","name":"Geschichtsreflexionen in Literatur und Film"},{"uid":1367,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/geschlechtersensibler-sportunterricht.html","name":"Geschlechtersensibler Sportunterricht"},{"uid":1461,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gespraechsforschung.html","name":"Gespr\u00e4chsforschung"},{"uid":901,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gestaltung-und-bemessung-von-verkehrsanlagen.html","name":"Gestaltung und Bemessung von Verkehrsanlagen"},{"uid":621,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gesundheitssport.html","name":"Gesundheitssport"},{"uid":91,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gewalt-und-konfliktforschung.html","name":"Gewalt- und Konfliktforschung"},{"uid":941,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gewaesserentwicklungsplanung.html","name":"Gew\u00e4sserentwicklungsplanung"},{"uid":939,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gewaesserguete.html","name":"Gew\u00e4sserg\u00fcte"},{"uid":399,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gleichnisse-wunder-biblische-eschatologie-juedisch-christliches-gottesbild.html","name":"Gleichnisse, Wunder, biblische Eschatologie, j\u00fcdisch-christliches Gottesbild"},{"uid":1237,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/goethes-farbenlehre.html","name":"Goethes Farbenlehre"},{"uid":1467,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/grammatik.html","name":"Grammatik"},{"uid":499,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/grammatiktheorie.html","name":"Grammatiktheorie"},{"uid":1149,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/grossflaechige-optoelektronik.html","name":"Gro\u00dffl\u00e4chige Optoelektronik"},{"uid":1173,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/grossflaechige-optoelektronik-1.html","name":"Gro\u00dffl\u00e4chige Optoelektronik"},{"uid":985,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/grundlagenforschung-feuerwehr.html","name":"Grundlagenforschung Feuerwehr"},{"uid":1373,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/grundschulsport.html","name":"Grundschulsport"},{"uid":877,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/gueterverkehr.html","name":"G\u00fcterverkehr"},{"uid":1293,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hadronen-und-kernpysik.html","name":"Hadronen- und Kernpysik"},{"uid":1264,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/halbleitende-polymermaterialien.html","name":"Halbleitende Polymermaterialien"},{"uid":1345,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/handlungstheorie.html","name":"Handlungstheorie"},{"uid":1357,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/handlungstheorien.html","name":"Handlungstheorien"},{"uid":611,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/handschriftenkunde.html","name":"Handschriftenkunde"},{"uid":1527,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/health-economics.html","name":"Health Economics"},{"uid":321,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hermeneutik-des-neuen-testaments.html","name":"Hermeneutik des Neuen Testaments"},{"uid":1279,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/heterogene-chemie.html","name":"Heterogene Chemie"},{"uid":1365,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/heterogenitaet-im-schulsport.html","name":"Heterogenit\u00e4t im Schulsport"},{"uid":497,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/heuristik.html","name":"Heuristik"},{"uid":511,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/higgs-boson-physik.html","name":"Higgs-Boson-Physik"},{"uid":1,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hochleistungsrechnen.html","name":"High Performance Computing"},{"uid":443,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hilfswissenschaften.html","name":"Hilfswissenschaften"},{"uid":1489,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hip-hop-studies.html","name":"Hip Hop Studies"},{"uid":111,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/historische-kunstlehre.html","name":"Historische Kunstlehre"},{"uid":147,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hochbegabung.html","name":"Hochbegabung"},{"uid":509,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hochenergiephysik.html","name":"Hochenergiephysik"},{"uid":469,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hochschuldidaktik.html","name":"Hochschuldidaktik"},{"uid":299,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hochschulforschung.html","name":"Hochschulforschung"},{"uid":919,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hochwasserschutz-hochwassermanagement.html","name":"Hochwasserschutz, Hochwassermanagement"},{"uid":179,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/holocaust-studies.html","name":"Holocaust Studies"},{"uid":1242,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/homotopietheorie.html","name":"Homotopietheorie"},{"uid":1441,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hpc-middleware.html","name":"HPC Middleware"},{"uid":133,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/humanismus.html","name":"Humanismus"},{"uid":85,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/humanismus-antikenrezeption-briefliteratur.html","name":"Humanismus, Antikenrezeption, Briefliteratur"},{"uid":1391,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hydraulik.html","name":"Hydraulik"},{"uid":915,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hydraulische-leistungsfaehigkeit-von-strassenablaeufen.html","name":"Hydraulische Leistungsf\u00e4higkeit von Stra\u00dfenabl\u00e4ufen"},{"uid":529,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/hydrochemie.html","name":"Hydrochemie"},{"uid":1645,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/icecube-south-pole-neutrino-observatory.html","name":"IceCube South Pole Neutrino Observatory"},{"uid":1607,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/ideengeschichte.html","name":"Ideengeschichte"},{"uid":421,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/immersionsforschung.html","name":"Immersionsforschung"},{"uid":57,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/industrial-design.html","name":"Industrial Design"},{"uid":715,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/industrielle-bildsignalverarbeitung.html","name":"Industrial image processing"},{"uid":345,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/industrie-40.html","name":"Industrie 4.0"},{"uid":1097,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/industrielle-druckverfahren.html","name":"Industrielle Druckverfahren"},{"uid":1083,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/informationsmanagement.html","name":"Informationsmanagement"},{"uid":1651,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/informationsmanagement-in-der-gefahrenabwehr.html","name":"Informationsmanagement in der Gefahrenabwehr"},{"uid":797,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/informationsstruktur-theorie-und-analyse.html","name":"Informationsstruktur: Theorie und Analyse"},{"uid":889,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/infrastrukturplanung.html","name":"Infrastrukturplanung"},{"uid":1587,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/ingenieurdidaktik.html","name":"Ingenieurdidaktik"},{"uid":1049,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/inkjetdruck.html","name":"Inkjetdruck"},{"uid":169,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/inklusion.html","name":"Inklusion"},{"uid":1369,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/inklusion-im-schulsport.html","name":"Inklusion im Schulsport"},{"uid":639,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/inklusion-im-technischen-fachunterricht.html","name":"Inklusion im technischen Fachunterricht"},{"uid":1535,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/inklusive-bildung-im-mathematikunterricht.html","name":"Inklusive Bildung im Mathematikunterricht"},{"uid":1371,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/inklusiver-schulsport.html","name":"Inklusiver Schulsport"},{"uid":235,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/innovationen-im-bildungswesen.html","name":"Innovationen im Bildungswesen"},{"uid":563,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/innovationsmanagement.html","name":"Innovationsmanagement"},{"uid":63,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/innovationsmethoden.html","name":"Innovationsmethoden"},{"uid":249,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/innovative-mechatronik.html","name":"Innovative Mechatronik"},{"uid":287,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/institutioneller-wandel-der-grossforschung.html","name":"Institutioneller Wandel der Gro\u00dfforschung"},{"uid":1377,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/integration-sozialisation-von-mitarbeitern.html","name":"Integration & Sozialisation von Mitarbeitern"},{"uid":377,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/intelligente-netze.html","name":"Intelligente Netze"},{"uid":1585,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/interaktionale-soziolinguistik.html","name":"Interaktionale Soziolinguistik"},{"uid":1483,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/interkulturelle-musikpaedagogik.html","name":"Interkulturelle Musikp\u00e4dagogik"},{"uid":1485,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/interkulturelle-musikpaedagogik-1.html","name":"Interkulturelle Musikp\u00e4dagogik"},{"uid":1403,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/interkulturelles-lernen-1.html","name":"Interkulturelles Lernen"},{"uid":219,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/interkulturelles-lernen.html","name":"Interkulturelles Lernen"},{"uid":1349,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/international-vergleichende-sozialforschung.html","name":"International vergleichende Sozialforschung"},{"uid":1355,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/international-vergleichende-sozialforschung-1.html","name":"International vergleichende Sozialforschung"},{"uid":1209,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/internationale-chemie-wettbewerbe.html","name":"Internationale Chemie-Wettbewerbe"},{"uid":225,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/internet-der-dinge-1.html","name":"Internet der Dinge"},{"uid":163,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/interpersonale-attraktion.html","name":"Interpersonale Attraktion"},{"uid":1027,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/intron-analysen.html","name":"Intron-Analysen,"},{"uid":491,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/ionen-molekuel-reaktionen.html","name":"Ionen-Molek\u00fcl Reaktionen"},{"uid":495,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/ionisationsverfahren-fuer-die-massenspektrometrie.html","name":"Ionisationsverfahren f\u00fcr die Massenspektrometrie"},{"uid":1583,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/jugendsprachen-1.html","name":"Jugendsprachen"},{"uid":1455,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/jugendsprachen.html","name":"Jugendsprachen"},{"uid":1244,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/k-theorie.html","name":"K-Theorie"},{"uid":1248,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/k-theorie-1.html","name":"K-Theorie"},{"uid":1254,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/k-theorie-2.html","name":"K-Theorie"},{"uid":485,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kapitalmaerkte.html","name":"Kapitalm\u00e4rkte"},{"uid":1289,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kardiovaskulaere-erkrankungen.html","name":"Kardiovaskul\u00e4re Erkrankungen"},{"uid":1325,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/katalyse.html","name":"Katalyse"},{"uid":1051,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kinder-und-jugendlichen-psychologie.html","name":"Kinder- und Jugendlichen Psychologie"},{"uid":457,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kinder-und-jugendliteratur-im-religionsunterricht.html","name":"Kinder- und Jugendliteratur im Religionsunterricht"},{"uid":1421,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kinder-und-jugendsport.html","name":"Kinder- und Jugendsport"},{"uid":963,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kindheit.html","name":"Kindheit"},{"uid":445,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kirchengeschichte.html","name":"Kirchengeschichte"},{"uid":1637,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/klassenfuehrung.html","name":"Klassenf\u00fchrung"},{"uid":1499,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/klassisches-athen.html","name":"Klassisches Athen"},{"uid":1119,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kommunale-sportentwicklungsplanung.html","name":"Kommunale Sportentwicklungsplanung"},{"uid":297,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/komparative-makrosoziologie.html","name":"Komparative Makrosoziologie"},{"uid":221,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kompetenz-und-aufgabenorientierung.html","name":"Kompetenz- und Aufgabenorientierung"},{"uid":1633,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kompetenzentwicklung-im-praxissemester.html","name":"Kompetenzentwicklung im Praxissemester"},{"uid":633,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kompetenzmodellierung-chemiebezogener-ausbildungsberufe.html","name":"Kompetenzmodellierung chemiebezogener Ausbildungsberufe"},{"uid":897,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kompetenzorientierung-und-vermittlung-sprachlicher-strukturen-wortschatz-grammatik.html","name":"Kompetenzorientierung und Vermittlung sprachlicher Strukturen (Wortschatz \/ Grammatik)"},{"uid":1381,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/komplexe-interventionen.html","name":"Komplexe Interventionen"},{"uid":1240,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/komplexe-mannigfaltigkeiten.html","name":"Komplexe Mannigfaltigkeiten, Garben- und Cohomologietheorie"},{"uid":1433,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kompositionsdidaktik-aus-internationaler-perspektive.html","name":"Kompositionsdidaktik aus internationaler Perspektive"},{"uid":1313,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kompositionsdidaktik-im-allgemeinbindenden-musikunterricht.html","name":"Kompositionsdidaktik im allgemeinbindenden Musikunterricht"},{"uid":1315,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kompositionsdidaktik-im-internationalen-kontext.html","name":"Kompositionsdidaktik im internationalen Kontext"},{"uid":1268,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/konjugierte-polyelektrolyte.html","name":"Konjugierte Polyelektrolyte"},{"uid":805,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/konstruktion.html","name":"Konstruktion"},{"uid":59,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/konstruktionssystematik.html","name":"Konstruktionssystematik"},{"uid":1447,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/konstruktivismus-in-der-religionsdidaktik.html","name":"Konstruktivismus in der Religionsdidaktik"},{"uid":793,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kontrastive-linguistik-englisch-deutsch.html","name":"Kontrastive Linguistik Englisch \/ Deutsch"},{"uid":1579,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/konversationsanalyse-gespraechsforschung.html","name":"Konversationsanalyse \/ Gespr\u00e4chsforschung"},{"uid":871,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/konzeptionelle-planungsdidaktik.html","name":"Konzeptionelle Planungsdidaktik (u.a. Gesundheitsf\u00f6rderung, Mehrperspektivit\u00e4t)"},{"uid":1309,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kooperatives-lernen.html","name":"Kooperatives Lernen"},{"uid":1299,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kosmische-strahlung.html","name":"Kosmische Strahlung"},{"uid":863,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kraft-waerme-kopplung-2.html","name":"Kraft-W\u00e4rme-Kopplung"},{"uid":65,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/krankenhauscontrolling.html","name":"Krankenhauscontrolling"},{"uid":67,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/krankenhausmanagement.html","name":"Krankenhausmanagement"},{"uid":1079,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kreislaufpotenziale-im-hochbau.html","name":"Kreislaufpotenziale im Hochbau"},{"uid":1163,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kristalline-nanostrukturen.html","name":"kristalline Nanostrukturen"},{"uid":1189,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kristalline-nanostrukturen-1.html","name":"Kristalline Nanostrukturen"},{"uid":1143,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kristalline-nanostrukturen-auf-dehnbaren-substraten.html","name":"kristalline Nanostrukturen auf dehnbaren Substraten"},{"uid":1647,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kritische-infrastrukturen.html","name":"Kritische Infrastrukturen"},{"uid":1509,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kultur-und-technik.html","name":"Kultur und Technik"},{"uid":1621,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kulturgeschichte.html","name":"Kulturgeschichte"},{"uid":141,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kunst-und-diaetetik.html","name":"Kunst und Di\u00e4tetik"},{"uid":139,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kunst-und-krieg.html","name":"Kunst und Krieg"},{"uid":1601,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kunstdidaktik.html","name":"Kunstdidaktik"},{"uid":1481,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kunstgeschichte.html","name":"Kunstgeschichte"},{"uid":101,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kunstgeschichte-der-fruehen-neuzeit.html","name":"Kunstgeschichte der Fr\u00fchen Neuzeit"},{"uid":113,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kunstgeschichte-in-der-kunstpaedagogik-1.html","name":"Kunstgeschichte in der Kunstp\u00e4dagogik"},{"uid":1411,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kuenstliche-intelligenz.html","name":"K\u00fcnstliche Intelligenz"},{"uid":945,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/kuesteningenieurwesen.html","name":"K\u00fcsteningenieurwesen"},{"uid":507,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/large-hadron-collider.html","name":"Large Hadron Collider"},{"uid":1139,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/laserdisplays.html","name":"Laserdisplays"},{"uid":1181,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/laserdisplays-1.html","name":"Laserdisplays"},{"uid":1157,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/laserscanner.html","name":"Laserscanner"},{"uid":1183,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/laserscanner-1.html","name":"Laserscanner"},{"uid":513,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/laserspektroskopie.html","name":"Laserspektroskopie"},{"uid":1541,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lehr-lern-labore.html","name":"Lehr-Lern-Labore"},{"uid":1577,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lehrerprofessionalisierung.html","name":"Lehrerprofessionalisierung"},{"uid":1205,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lehrfilme-fuer-individuelles-lernen.html","name":"Lehrfilme f\u00fcr individuelles Lernen"},{"uid":767,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/leichtbau.html","name":"Leichtbau"},{"uid":213,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/leistungsbeurteilung.html","name":"Leistungsbeurteilung"},{"uid":353,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/leistungsbewertung.html","name":"Leistungsbewertung"},{"uid":307,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/leistungsdiagnostik.html","name":"Leistungsdiagnostik"},{"uid":1451,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/leistungselektronik.html","name":"Leistungselektronik"},{"uid":1639,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lernen-mit-animationen.html","name":"Lernen mit Animationen"},{"uid":1631,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lernen-mit-text-und-bild.html","name":"Lernen mit Text und Bild"},{"uid":745,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lernbeeintraechtigungen.html","name":"Lernst\u00f6rungen"},{"uid":1629,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lernstrategien.html","name":"Lernstrategien"},{"uid":589,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lesedidaktik.html","name":"Lesedidaktik"},{"uid":207,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lesen-lernen-im-englischunterricht-der-grundschule.html","name":"Lesen lernen im Englischunterricht der Grundschule"},{"uid":1291,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lesesozialisation-kinder-und-jugendliteratur-aesthetische-erfahrung.html","name":"Lesesozialisation, Kinder- und Jugendliteratur, \u00e4sthetische Erfahrung"},{"uid":671,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lhc-epistemology.html","name":"LHC-Epistemology"},{"uid":479,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/linguistische-unterrichtsforschung.html","name":"Linguistische Unterrichtsforschung"},{"uid":1706,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/literarische-anthropologie.html","name":"Literarische Anthropologie"},{"uid":1513,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/literatur-der-moderne.html","name":"Literatur der Moderne"},{"uid":1131,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/logistik.html","name":"Logistik"},{"uid":787,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lokale-flexibilitaetsmaerkte.html","name":"Lokale Flexibilit\u00e4tsm\u00e4rkte"},{"uid":927,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lufteintrag-auf-treppenschussrinnen.html","name":"Lufteintrag auf Treppenschussrinnen"},{"uid":1125,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/lyriktheorie.html","name":"Lyriktheorie"},{"uid":1329,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/machine-data-mining.html","name":"Machine Data Mining"},{"uid":1409,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/machine-learning-1.html","name":"Machine Learning"},{"uid":1415,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/machine-learning-2.html","name":"Machine Learning"},{"uid":87,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/macht-und-herrschaft.html","name":"Macht und Herrschaft"},{"uid":1643,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/magnetische-monopole.html","name":"Magnetische Monopole"},{"uid":69,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/managementverguetung.html","name":"Managementverg\u00fctung"},{"uid":617,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/market-microstructure.html","name":"Market Microstructure"},{"uid":707,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/maschinelles-lernen.html","name":"Maschinelles Lernen"},{"uid":15,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/maschinensicherheit.html","name":"Maschinensicherheit"},{"uid":1559,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/massendaten.html","name":"Massendaten"},{"uid":1081,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/materialbibliothek.html","name":"Materialbibliothek"},{"uid":81,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/materialwissenschaft-und-werkstofftechnik.html","name":"Materialwissenschaft und Werkstofftechnik"},{"uid":1537,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mathematische-begabungen.html","name":"Mathematische Begabungen"},{"uid":201,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mathematische-optimierung.html","name":"Mathematische Optimierung"},{"uid":1443,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mechatronik.html","name":"Mechatronik"},{"uid":1687,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mediendidaktik.html","name":"Mediendidaktik"},{"uid":1581,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/medienlinguistik.html","name":"Medienlinguistik"},{"uid":125,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/medientheorie.html","name":"Medientheorie"},{"uid":157,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mehrphasenstroemungen-1.html","name":"Mehrphasenstr\u00f6mungen"},{"uid":405,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mehrphasensysteme.html","name":"Mehrphasensysteme"},{"uid":159,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mehrsprachigkeit.html","name":"Mehrsprachigkeit"},{"uid":217,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mehrsprachigkeitsdidaktik.html","name":"Mehrsprachigkeitsdidaktik"},{"uid":181,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/memory-culture.html","name":"Memory Culture"},{"uid":1387,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/messen-und-hydrometrie.html","name":"Messen und Hydrometrie"},{"uid":1283,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/messgeraeteentwicklung.html","name":"Messger\u00e4teentwicklung"},{"uid":431,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/messtechnik.html","name":"Messtechnik"},{"uid":755,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/metaanalyse.html","name":"Metaanalyse"},{"uid":83,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/metallische-werkstoffe.html","name":"Metallische Werkstoffe"},{"uid":1383,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/methodenentwicklung-in-der-versorgungsforschung.html","name":"Methodenentwicklung in der Versorgungsforschung"},{"uid":7,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/methodik-und-methoden-der-arbeitssicherheit.html","name":"Methodik und Methoden der Arbeitssicherheit"},{"uid":1287,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/micro-rnas.html","name":"micro-RNAs"},{"uid":267,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/migrationspaedagogische-forschung.html","name":"Migrationsp\u00e4dagogische Forschung"},{"uid":1266,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mikroporoese-netzwerke.html","name":"Mikropor\u00f6se Netzwerke"},{"uid":717,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mint-ausbildung-von-schuelern.html","name":"MINT-Ausbildung von Sch\u00fclern"},{"uid":679,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mittelspannugsschaltanlagen.html","name":"Mittelspannugsschaltanlagen"},{"uid":907,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mobilitaet-und-sicherheit-von-kindern-und-aelteren-menschen.html","name":"Mobilit\u00e4t und Sicherheit von Kindern und \u00e4lteren Menschen"},{"uid":175,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mobilitaetsverhalten.html","name":"Mobilit\u00e4tsverhalten"},{"uid":349,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/modellierung.html","name":"Modellierung"},{"uid":979,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/molecular-symmetry.html","name":"Molecular symmetry"},{"uid":1029,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/molekulare-evolution-von-protisten.html","name":"Molekulare Evolution von Protisten"},{"uid":1285,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/molekulare-sportmedizin.html","name":"Molekulare Sportmedizin"},{"uid":151,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/motivationale-und-emotionale-bedingungsfaktoren-schulischen-lernens.html","name":"Motivationale und emotionale Bedingungsfaktoren schulischen Lernens"},{"uid":1246,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/motivische-homotopietheorie.html","name":"Motivische Homotopietheorie"},{"uid":1252,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/motivische-homotopietheorie-1.html","name":"Motivische Homotopietheorie"},{"uid":1256,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/motivische-homotopietheorie-2.html","name":"Motivische Homotopietheorie"},{"uid":303,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/motor-control.html","name":"Motor control"},{"uid":685,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/mehrdimensionale-systeme.html","name":"Multidimensional systems and signal processing"},{"uid":969,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/multikriterielle-optimierung.html","name":"Multikriterielle Optimierung"},{"uid":1201,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/multimedia-in-der-lehre.html","name":"Multimedia in der Lehre"},{"uid":1429,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/musikalische-bildungsforschung.html","name":"Musikalische Bildungsforschung"},{"uid":1431,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/musikgeschichte-in-didaktischer-perspektive.html","name":"Musikgeschichte in didaktischer Perspektive"},{"uid":1427,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/musiktheaterpaedagogik.html","name":"Musiktheaterp\u00e4dagogik"},{"uid":177,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/namibian-studies.html","name":"Namibian Studies"},{"uid":1169,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/nanoimprintlithografie.html","name":"Nanoimprintlithografie"},{"uid":1195,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/nanoimprintlithografie-1.html","name":"Nanoimprintlithografie"},{"uid":1165,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/nanopartikel.html","name":"Nanopartikel"},{"uid":1191,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/nanopartikel-1.html","name":"Nanopartikel"},{"uid":1141,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/nanotechnologie.html","name":"Nanotechnologie"},{"uid":1167,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/nanotransferdruck.html","name":"Nanotransferdruck"},{"uid":1193,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/nanotransferdruck-1.html","name":"Nanotransferdruck"},{"uid":325,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/narratologie.html","name":"Narratologie"},{"uid":673,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/naturalness.html","name":"Naturalness"},{"uid":1323,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/naturstoffe.html","name":"Naturstoffe"},{"uid":761,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/need-for-cognition.html","name":"Need for Cognition"},{"uid":791,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/netzautomatisierung.html","name":"Netzautomatisierung"},{"uid":371,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/netzbetrieb.html","name":"Netzbetrieb"},{"uid":333,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/netze.html","name":"Netze"},{"uid":369,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/netzplanung-1.html","name":"Netzplanung"},{"uid":865,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/netzstrukturen-2.html","name":"Netzstrukturen"},{"uid":823,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/netzwerkmodelle.html","name":"Netzwerkmodelle"},{"uid":833,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/neuartige-betriebskonzepte.html","name":"Neuartige Betriebskonzepte"},{"uid":1704,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/neuere-deutsche-literaturgeschichte.html","name":"Neuere deutsche Literaturgeschichte"},{"uid":1679,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/neueste-geschichte.html","name":"Neueste Geschichte"},{"uid":319,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/neutestamentliche-exegese-1.html","name":"Neutestamentliche Exegese"},{"uid":1274,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/nichtarchimedische-geometrie.html","name":"Nichtarchimedische Geometrie"},{"uid":943,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/niederschlags-abfluss-modellierung-na.html","name":"Niederschlags-\/Abfluss-Modellierung (N\/A)"},{"uid":999,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerik-grosser-gleichungssysteme.html","name":"Numerik gro\u00dfer Gleichungssysteme"},{"uid":997,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerische-elektromagnetische-felddosimetrie.html","name":"Numerische elektromagnetische Felddosimetrie"},{"uid":1007,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerische-feldberechnung-induktiver-ladesysteme.html","name":"Numerische Feldsimulation induktiver Ladesysteme"},{"uid":401,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerische-fluid-struktur-kopplung.html","name":"Numerische Fluid-Struktur-Kopplung"},{"uid":1023,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerische-lineare-algebra.html","name":"Numerische Lineare Algebra"},{"uid":1009,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerische-magnetfeldberechnung.html","name":"Numerische Magnetfeldberechnung"},{"uid":605,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerische-mathematik.html","name":"Numerische Mathematik"},{"uid":1053,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerische-simulation.html","name":"Numerische Simulation"},{"uid":667,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerische-simulation-gekoppelter-systeme-in-den-ingenieur-und-naturwissenschaften.html","name":"Numerische Simulation gekoppelter Systeme in den Ingenieur- und Naturwissenschaften"},{"uid":409,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/numerische-stroemungsberechnung-cfd.html","name":"Numerische Str\u00f6mungsberechnung (CFD)"},{"uid":709,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/objekt-klassifikation.html","name":"Objekt Klassifikation"},{"uid":247,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/objektsicherheit.html","name":"Objektsicherheit"},{"uid":1375,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/onboarding.html","name":"Onboarding"},{"uid":173,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/oepnv.html","name":"\u00d6PNV"},{"uid":1221,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/optik.html","name":"Optik"},{"uid":187,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/optimierungsverfahren.html","name":"Optimierungsverfahren"},{"uid":415,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/organisation-und-management-der-nicht-polizeilichen-gefahrenabwehr.html","name":"Organisation und Management der nicht-polizeilichen Gefahrenabwehr"},{"uid":253,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/organisationales-commitment.html","name":"Organisationales Commitment"},{"uid":295,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/organisationsforschung.html","name":"Organisationsforschung"},{"uid":1321,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/organische-chemie.html","name":"Organische Chemie"},{"uid":1471,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/ornament.html","name":"Ornament"},{"uid":1465,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/schriftsystem-und-orthographie.html","name":"Orthographie"},{"uid":149,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/paedagogisch-psychologische-diangostik.html","name":"P\u00e4dagogisch-psychologische Diangostik"},{"uid":1685,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/paedagogische-psychologie-und-digitale-lernmedien.html","name":"P\u00e4dagogische Psychologie und digitale Lernmedien"},{"uid":447,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/papsttum.html","name":"Papsttum"},{"uid":209,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/paralleler-schriftspracherwerb-deutsch-englisch.html","name":"Paralleler Schriftspracherwerb Deutsch Englisch"},{"uid":1055,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/paralleles-rechnen.html","name":"Paralleles Rechnen"},{"uid":79,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/partikeltechnologie.html","name":"Partikeltechnologie"},{"uid":327,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/paulus.html","name":"Paulus"},{"uid":1417,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/performance-von-gebaeuden-1.html","name":"Performance von Geb\u00e4uden"},{"uid":439,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/performance-von-gebaeuden.html","name":"Performance von Geb\u00e4uden"},{"uid":759,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/personale-intelligenz.html","name":"Personale Intelligenz"},{"uid":1111,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/personalentwicklung.html","name":"Personalentwicklung"},{"uid":911,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/personenstroeme.html","name":"Personenstr\u00f6me"},{"uid":887,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/personenwirtschaftsverkehr.html","name":"Personenwirtschaftsverkehr"},{"uid":1223,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/phaenomenologie.html","name":"Ph\u00e4nomenologie"},{"uid":1231,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/phaenomenologische-naturzugaenge.html","name":"Ph\u00e4nomenologische Naturzug\u00e4nge"},{"uid":1227,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/phaenomenologische-optik.html","name":"Ph\u00e4nomenologische Optik"},{"uid":493,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/phasentransferprozesse.html","name":"Phasentransferprozesse"},{"uid":1708,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/photochemie.html","name":"Photochemie"},{"uid":1281,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/photokatalyse.html","name":"Photokatalyse"},{"uid":1399,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/physik-jenseits-des-standardmodells.html","name":"Physik jenseits des Standardmodells"},{"uid":1405,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/physik-jenseits-des-standardmodells-2.html","name":"Physik jenseits des Standardmodells"},{"uid":167,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/physische-attraktivitaet.html","name":"Physische Attraktivit\u00e4t"},{"uid":1161,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/plagiatsschutz.html","name":"Plagiatsschutz"},{"uid":1187,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/plagiatsschutz-1.html","name":"Plagiatsschutz"},{"uid":743,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/planungsgrundsaetze-fuer-verteilungsnetze.html","name":"Planungsgrunds\u00e4tze f\u00fcr Verteilungsnetze"},{"uid":1151,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/plasmonik.html","name":"Plasmonik"},{"uid":1175,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/plasmonik-1.html","name":"Plasmonik"},{"uid":329,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/plurizentrik.html","name":"Plurizentrik"},{"uid":1341,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/politische-partizipation.html","name":"Politische Partizipation"},{"uid":1351,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/politische-partizipation-1.html","name":"Politische Partizipation"},{"uid":1521,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/polymerloesungen-im-tunnel-und-spezialtiefbau.html","name":"Polymerl\u00f6sungen im Tunnel- und Spezialtiefbau"},{"uid":1487,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/popular-music-studies.html","name":"Popular Music Studies"},{"uid":1613,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/populismus-1.html","name":"Populismus"},{"uid":95,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/populismus.html","name":"Populismus"},{"uid":1305,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/positionen-der-literaturdidaktik-kinderliteraturforschung-prozeduralisierung-von-gattungswissen-ae.html","name":"Positionen der Literaturdidaktik, Kinderliteraturforschung, Prozeduralisierung von Gattungswissen, \u00e4sthetische Erfahrung"},{"uid":891,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/postdigitale-darstellungsmethoden.html","name":"Postdigitale Darstellungsmethoden"},{"uid":127,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/postfossile-stadt-und-mobilitaet.html","name":"Postfossile Stadt und Mobilit\u00e4t"},{"uid":861,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/power-to-gas-2.html","name":"Power-to-Gas"},{"uid":803,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/pragmatik.html","name":"Pragmatik"},{"uid":257,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/praesentismus.html","name":"Pr\u00e4sentismus"},{"uid":623,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/praeventionssport.html","name":"Pr\u00e4ventionssport"},{"uid":1569,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/praxissemester.html","name":"Praxissemester"},{"uid":579,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/produkt-service-systeme.html","name":"Produkt-Service-Systeme"},{"uid":807,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/produktentwicklung.html","name":"Produktentwicklung"},{"uid":1129,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/produktionsplanung.html","name":"Produktionsplanung"},{"uid":577,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/produktlebenszyklus.html","name":"Produktlebenszyklus"},{"uid":14,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/produktsicherheit.html","name":"Produktsicherheit"},{"uid":1395,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/professionalisierung-von-engischlehrkraeften.html","name":"Professionalisierung von Engischlehrkr\u00e4ften"},{"uid":293,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/professionssoziologie.html","name":"Professionssoziologie"},{"uid":1317,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/projektarbeit-in-der-kulturellen-bildung-kulturcampus-wuppertal.html","name":"Projektarbeit in der kulturellen Bildung (KulturCampus Wuppertal)"},{"uid":873,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/projekte-zur-sportentwicklung.html","name":"Projekte zur Sportentwicklung"},{"uid":1425,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/projektorientiertes-lehren-und-lernen.html","name":"Projektorientiertes Lehren und Lernen"},{"uid":517,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/provenzalische-sprache-und-literatur.html","name":"Provenzalische Sprache und Literatur"},{"uid":337,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/prozess-analyse.html","name":"Prozess-Analyse"},{"uid":1013,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/prozessmodellierung.html","name":"Prozessmodellierung"},{"uid":1379,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/psychische-beanspruchung-und-emotionales-erleben.html","name":"Psychische Beanspruchung und emotionales Erleben"},{"uid":757,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/psychometrie.html","name":"Psychometrie"},{"uid":1525,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/public-economics.html","name":"Public Economics"},{"uid":1207,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/public-understanding-of-science.html","name":"Public Understanding of Science"},{"uid":581,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/qualitaet.html","name":"Qualit\u00e4t"},{"uid":1069,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/qualitaetsbewertung-von-3d-druckern-und-3d-scannern-1.html","name":"Qualit\u00e4tsbewertung von 3D-Druckern und 3D-Scannern"},{"uid":1272,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/quantenfeldtheorie-auf-dem-gitter.html","name":"Quantenfeldtheorie auf dem Gitter "},{"uid":817,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/quantenphasenuebergaenge.html","name":"Quantenphasen\u00fcberg\u00e4nge"},{"uid":819,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/quantenspinsysteme.html","name":"Quantenspinsysteme"},{"uid":301,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/quantitative-methoden.html","name":"Quantitative Methoden"},{"uid":1127,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/quantitative-methoden-zur-entscheidungunterstuetzung.html","name":"Quantitative Methoden zur Entscheidungunterst\u00fctzung"},{"uid":821,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/quantum-computation.html","name":"Quantum Computation"},{"uid":1361,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/quartiersoptimierung.html","name":"Quartiersoptimierung"},{"uid":959,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/quasigebundene-zustaende.html","name":"Quasibound states"},{"uid":451,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/quellenkunde.html","name":"Quellenkunde"},{"uid":903,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rad-und-fussverkehr.html","name":"Rad- und Fu\u00dfverkehr"},{"uid":1473,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rahmen.html","name":"Rahmen"},{"uid":265,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rassismus-und-antisemitismusforschung.html","name":"Rassismus- und Antisemitismusforschung"},{"uid":433,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/raumklima.html","name":"Raumklima"},{"uid":1531,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/echtzeitdatenbanken.html","name":"Real-Time Databases"},{"uid":695,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/realzeit-signalverarbeitung.html","name":"Realtime signal processing"},{"uid":1439,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rechnerarchitektur.html","name":"Rechnerarchitektur"},{"uid":995,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rechnergestuetzte-elektromagnetische-feldtheorie.html","name":"Rechnergest\u00fctzte elektromagnetische Feldtheorie"},{"uid":1663,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rechnergestuetzte-gruppen-und-darstellungstheorie.html","name":"Rechnergest\u00fctzte Gruppen- und Darstellungstheorie"},{"uid":73,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rechnungswesen.html","name":"Rechnungswesen"},{"uid":613,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rechtsgeschichte.html","name":"Rechtsgeschichte"},{"uid":1575,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/reflexion.html","name":"Reflexion"},{"uid":1635,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/reflexionsfaehigkeit-in-praxisphasen.html","name":"Reflexionsf\u00e4higkeit in Praxisphasen"},{"uid":363,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/regenerative-energie.html","name":"Regenerative Energie"},{"uid":625,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rehabilitationssport.html","name":"Rehabilitationssport"},{"uid":1239,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/reine-mathematik-komplexe-anaysis.html","name":"Reine Mathematik \/ Komplexe Anaysis"},{"uid":567,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/reiseliteratur.html","name":"Reiseliteratur"},{"uid":2,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/verifikationsnumerik.html","name":"Reliable computing"},{"uid":557,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/religionswissenschaft.html","name":"Religionswissenschaft"},{"uid":391,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/resilienz.html","name":"Resilienz"},{"uid":383,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/ressourceneffizienz.html","name":"Ressourceneffizienz"},{"uid":389,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/risiko.html","name":"Risiko"},{"uid":1445,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/robotik.html","name":"Robotik"},{"uid":449,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rom.html","name":"Rom"},{"uid":1501,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/roemische-religion.html","name":"R\u00f6mische Religion"},{"uid":615,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/roemisches-recht-im-mittelalter.html","name":"R\u00f6misches Recht im Mittelalter"},{"uid":763,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/roentgenstreubildgebung.html","name":"R\u00f6ntgenstreubildgebung"},{"uid":561,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rudolf-ottos-das-heilige.html","name":"Rudolf Ottos 'Das Heilige'"},{"uid":1015,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/rutschhemmung-von-bodenbelaegen-und-schuhwerk.html","name":"Rutschhemmung von Bodenbel\u00e4gen und Schuhwerk"},{"uid":1089,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/safety-security-1.html","name":"Safety & Security"},{"uid":523,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/schadstoffe-in-boeden-pflanzen-waessern-und-sedimenten.html","name":"Schadstoffe in B\u00f6den, Pflanzen, W\u00e4ssern und Sedimenten"},{"uid":189,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/scheduling.html","name":"Scheduling"},{"uid":205,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/schriftspracherwerb.html","name":"Schriftspracherwerb"},{"uid":1557,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/schuelerindividualdaten.html","name":"Sch\u00fclerindividualdaten"},{"uid":1035,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/schuelerlabor-forschung.html","name":"Sch\u00fclerlabor-Forschung"},{"uid":1555,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/schulfinanzierung.html","name":"Schulfinanzierung"},{"uid":397,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/schulische-inklusion.html","name":"Schulische Inklusion"},{"uid":1551,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/schulwahl.html","name":"Schulwahl"},{"uid":1553,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/segregation.html","name":"Segregation"},{"uid":781,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sektorkopplung.html","name":"Sektorkopplung"},{"uid":859,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sektoruebergreifende-verteilnetzautomatisierung-1.html","name":"Sektor\u00fcbergreifende Verteilnetzautomatisierung"},{"uid":1573,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/selbstwirksamkeitserwartungen.html","name":"Selbstwirksamkeitserwartungen"},{"uid":801,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/semantik.html","name":"Semantik"},{"uid":723,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sensor-basierte-assistenzsysteme.html","name":"Sensor basierte Assistenzsysteme"},{"uid":245,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sichere-authentifizierung.html","name":"Sichere Authentifizierung"},{"uid":395,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sicherheit.html","name":"Sicherheit"},{"uid":351,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/simulation.html","name":"Simulation"},{"uid":955,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/simulation-der-rovibronischen-spektren-kleiner-molekuele.html","name":"Simulation of rovibronic spectra for small molecules"},{"uid":1005,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/simulation-von-betriebsmitteln-der-elektrischen-energieuebertragungstechnik.html","name":"Simulation von Betriebsmitteln der elektrischen Energie\u00fcbertragungstechnik"},{"uid":1185,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/simulation-von-optischen-duennschichten.html","name":"Simulation von optischen D\u00fcnnschichten"},{"uid":1159,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/simulation-von-optischen-duennschichtsystemen.html","name":"Simulation von optischen D\u00fcnnschichtsystemen"},{"uid":1057,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/simulationen-in-der-gittereichtheorie.html","name":"Simulationen in der Gittereichtheorie"},{"uid":1419,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/simulationswerkzeuge.html","name":"Simulationswerkzeuge"},{"uid":381,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/smart-grids-1.html","name":"Smart Grids"},{"uid":379,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/smart-market.html","name":"Smart Market"},{"uid":227,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/smart-packaging.html","name":"Smart Packaging"},{"uid":917,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sohlenbauwerke-sohlengleiten-und-sohlenrampen.html","name":"Sohlenbauwerke (Sohlengleiten und Sohlenrampen)"},{"uid":489,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/solar-decathlon.html","name":"Solar Decathlon"},{"uid":1099,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/solarenergie-im-staedtebaulichen-kontext.html","name":"Solarenergie im st\u00e4d\u00e4"},{"uid":429,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/solarenergienutzung.html","name":"Solarenergienutzung"},{"uid":1155,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/solarkonzentratoren.html","name":"Solarkonzentratoren"},{"uid":1179,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/solarkonzentratoren-1.html","name":"Solarkonzentratoren"},{"uid":697,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sonar-signalverarbeitung.html","name":"Sonar Signalverarbeitung"},{"uid":271,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sonderpaedagogik.html","name":"Sonderp\u00e4dagogik"},{"uid":1319,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/soziale-beziehungen-in-der-musikalischen-interaktion.html","name":"Soziale Beziehungen in der musikalischen Interaktion"},{"uid":275,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/soziale-erwuenschtheit.html","name":"Soziale Erw\u00fcnschtheit"},{"uid":1657,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/soziale-sicherungssysteme.html","name":"Soziale Sicherungssysteme"},{"uid":93,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/soziale-ungleichheit-und-eliten.html","name":"Soziale Ungleichheit und Eliten"},{"uid":89,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/soziale-ungleichheit-und-konflikt.html","name":"Soziale Ungleichheit und Konflikt"},{"uid":1563,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sozialindex.html","name":"Sozialindex"},{"uid":965,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sozialisation.html","name":"Sozialisation"},{"uid":119,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sozialpaedagogische-nutzerforschung-forschung-zur-inanspruchnahme-sozialer-dienstleistungen.html","name":"Sozialp\u00e4dagogische Nutzerforschung \/ Forschung zur Inanspruchnahme sozialer Dienstleistungen"},{"uid":1561,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sozialraumanalyse.html","name":"Sozialraumanalyse"},{"uid":97,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sozialstrukturanalyse-soziale-ungleichheit-und-eliten.html","name":"Sozialstrukturanalyse, soziale Ungleichheit und Eliten"},{"uid":1459,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/soziolingusitik.html","name":"Soziolingusitik"},{"uid":703,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/spatio-temporal-signal-processing.html","name":"Spatio-temporal signal processing"},{"uid":627,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sportarten-fussball-schwimmen.html","name":"Sportarten (Fu\u00dfball, Schwimmen)"},{"uid":1275,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sportgeschichte.html","name":"Sportgeschichte"},{"uid":1423,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sportspiele-handball-tennis.html","name":"Sportspiele"},{"uid":1121,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sportvereinsentwicklung.html","name":"Sportvereinsentwicklung"},{"uid":545,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sprachdiagnostik-bei-ein-und-mehrsprachigen-kindern-und-jugendlichen.html","name":"Sprachdiagnostik bei ein- und mehrsprachigen Kindern und Jugendlichen"},{"uid":599,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sprache-und-kommunikation-in-der-beruflichen-bildung.html","name":"Sprache und Kommunikation in der beruflichen Bildung"},{"uid":1463,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sprache-und-kommunikation-in-der-institution-schule.html","name":"Sprache und Kommunikation in der Institution Schule"},{"uid":477,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/spracherwerb-in-ein-und-mehrsprachigen-kontexten.html","name":"Spracherwerb in ein- und mehrsprachigen Kontexten"},{"uid":1457,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sprachliche-hoeflichkeit.html","name":"Sprachliche H\u00f6flichkeit"},{"uid":1615,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/staatsverschuldung.html","name":"Staatsverschuldung"},{"uid":1250,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stabile-homotopietheorie.html","name":"Stabile Homotopietheorie"},{"uid":1258,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stabile-homotopietheorie-1.html","name":"Stabile Homotopietheorie"},{"uid":1671,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stadt-und-architekturgeschichte.html","name":"Stadt- und Architekturgeschichte"},{"uid":1109,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/staedtebauliche-entwurfsmethoden.html","name":"St\u00e4dtebauliche Entwurfsmethoden"},{"uid":1103,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/staedtebauliche-planungsmethoden.html","name":"St\u00e4dtebauliche Planungsmethoden"},{"uid":1101,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/staedtebauliche-planungsprozesse.html","name":"St\u00e4dtebauliche Planungsprozesse"},{"uid":879,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stadtlogistik.html","name":"Stadtlogistik"},{"uid":1691,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stahl-verbund-metallleicht-holzbau.html","name":"Stahl-, Verbund-, Metallleicht- & Holzbau"},{"uid":815,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/starkkorrelierte-elektronensysteme.html","name":"Starkkorrelierte Elektronensysteme"},{"uid":1653,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/steuern.html","name":"Steuern"},{"uid":229,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stimuli-responsive-dyes.html","name":"Stimuli-responsive dyes"},{"uid":131,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/strassenraumgestaltung.html","name":"Stra\u00dfenraumgestaltung"},{"uid":1215,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stressforschung.html","name":"Stressforschung"},{"uid":1217,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stressforschung-1.html","name":"Stressforschung"},{"uid":1389,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stroemungsdynamik.html","name":"Str\u00f6mungsdynamik"},{"uid":403,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stroemungsmechnik.html","name":"Str\u00f6mungsmechnik"},{"uid":925,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/stroemungssimulationen-numerisch-physikalisch.html","name":"Str\u00f6mungssimulationen (numerisch, physikalisch)"},{"uid":765,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/strukturoptimierung.html","name":"Strukturoptimierung"},{"uid":923,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/sturzfluten.html","name":"Sturzfluten"},{"uid":1689,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/submodellbasierte-multi-level-optimierung.html","name":"Submodellbasierte Multi-Level-Optimierung"},{"uid":1211,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/suffizienz.html","name":"Suffizienz"},{"uid":427,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/swarm-algorithm-for-structural-analysis.html","name":"Swarm Algorithm for Structural Analysis"},{"uid":799,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/syntax.html","name":"Syntax"},{"uid":501,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/syntaxtheorie.html","name":"Syntaxtheorie"},{"uid":929,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/talsperrenbewirtschaftung.html","name":"Talsperrenbewirtschaftung"},{"uid":719,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/technik-kurse-fuer-schueler.html","name":"Technik-Kurse f\u00fcr Sch\u00fcler"},{"uid":721,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/technikausbildung-von-schuelerinnen-und-schuelern.html","name":"Technikausbildung von Sch\u00fclerinnen und Sch\u00fclern"},{"uid":637,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/technische-repraesentationsformen.html","name":"Technische Repr\u00e4sentationsformen"},{"uid":1337,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/technologiemanagement.html","name":"Technologiemanagement"},{"uid":1301,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/teilchendetektoren.html","name":"Teilchendetektoren"},{"uid":1295,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/teilchenphysik.html","name":"Teilchenphysik"},{"uid":315,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/teilenergiekennwerte-tek.html","name":"Teilenergiekennwerte (TEK)"},{"uid":553,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/textdynamik.html","name":"Textdynamik"},{"uid":957,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/der-renner-effekt.html","name":"The Renner Effect"},{"uid":961,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/theoretische-berechnungen-der-eigenschaften-von-festkoerpern.html","name":"Theoretical calculations of the properties of solids"},{"uid":117,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/theorie-und-analyse-personenbezogener-sozialer-dienstleistung.html","name":"Theorie und Analyse personenbezogener sozialer Dienstleistung"},{"uid":827,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/thermodynamik.html","name":"Thermodynamik"},{"uid":809,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/toleranzanalysen-und-toleranzmanagement-im-maschinenbau.html","name":"Toleranzanalysen und Toleranzmanagement im Maschinenbau"},{"uid":689,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/tomographische-rekonstruktionsverfahren.html","name":"Tomographische Rekonstruktionsverfahren"},{"uid":239,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/tomographie-1.html","name":"Tomography"},{"uid":505,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/top-quark-physik.html","name":"Top-Quark-Physik"},{"uid":773,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/topologieoptimierung.html","name":"Topologieoptimierung"},{"uid":419,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/tragoedienforschung.html","name":"Trag\u00f6dienforschung"},{"uid":1469,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/transkulturelle-kunstgeschichte-schwerpunkt-europa-und-naher-osten.html","name":"Transkulturelle Kunstgeschichte"},{"uid":1479,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/transkulturelle-kunstpaedagogik.html","name":"Transkulturelle Kunstp\u00e4dagogik"},{"uid":1517,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/transmedialitaet.html","name":"Transmedialit\u00e4t"},{"uid":1523,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/tribologie.html","name":"Tribologie"},{"uid":1095,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/trocknung-von-stark-verduennten-loesungen.html","name":"Trocknung von stark verd\u00fcnnten L\u00f6sungen"},{"uid":1437,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/typologietransformationen.html","name":"Typologietransformationen"},{"uid":635,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/uebergang-schule-in-gewerblich-technische-ausbildungsberufe.html","name":"\u00dcbergang Schule in gewerblich-technische Ausbildungsberufe"},{"uid":515,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/translationswissenschaft.html","name":"\u00dcbersetzungswissenschaft"},{"uid":1307,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/umgang-mit-heterogenitaet.html","name":"Umgang mit Heterogenit\u00e4t"},{"uid":1453,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/umrichterentwicklung.html","name":"Umrichterentwicklung"},{"uid":323,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/umwelt-des-neuen-testaments.html","name":"Umwelt des Neuen Testaments"},{"uid":129,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/umweltwirkungen-des-verkehrs.html","name":"Umweltwirkungen des Verkehrs"},{"uid":143,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/unternehmertum-an-hochschulen-university-entrepreneurship.html","name":"University Entrepreneurship"},{"uid":1655,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/unternehmensbesteuerung.html","name":"Unternehmensbesteuerung"},{"uid":575,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/unternehmensnetzwerkgestaltung.html","name":"Unternehmensnetzwerkgestaltung"},{"uid":1545,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/schuelerfirmen.html","name":"Unternehmertum an Hochschulen (University Entrepreneurship)"},{"uid":1061,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/unterrichtsforschung.html","name":"Unterrichtsforschung"},{"uid":1571,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/unterrichtsplanung.html","name":"Unterrichtsplanung"},{"uid":1311,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/unterrichtsqualitaet.html","name":"Unterrichtsqualit\u00e4t"},{"uid":1077,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/urban-mining-gerechtes-bauen.html","name":"Urban Mining gerechtes Bauen"},{"uid":251,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/usability.html","name":"Usability"},{"uid":4,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/user-experience-design.html","name":"User Experience Design"},{"uid":3,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/user-interface-design.html","name":"User Interface Design"},{"uid":1091,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/uv-strahlen-trocknungs-und-haertungsprozesse.html","name":"UV-Strahlen Trocknungs- und H\u00e4rtungsprozesse"},{"uid":551,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/variantenverzeichnung.html","name":"Variantenverzeichnung"},{"uid":331,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/variationslinguistik.html","name":"Variationslinguistik"},{"uid":1093,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/veredelungstechnologie-von-druckprodukten.html","name":"Veredelungstechnologie von Druckprodukten"},{"uid":407,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/verfahrenstechnik.html","name":"Verfahrenstechnik"},{"uid":1059,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/verfiziertes-numerisches-rechnen.html","name":"Verfiziertes numerisches Rechnen"},{"uid":885,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/verkehrskonzepte.html","name":"Verkehrskonzepte"},{"uid":899,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/verkehrssicherheit.html","name":"Verkehrssicherheit"},{"uid":1047,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/verpackungstechnik.html","name":"Verpackung u. Digitaldruckverfahren"},{"uid":1385,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/versorgung-vulnerabler-bevoelkerungsgruppen.html","name":"Versorgung vulnerabler Bev\u00f6lkerungsgruppen"},{"uid":541,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/versorgungsforschung.html","name":"Versorgungsforschung"},{"uid":241,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/video-signalverarbeitung.html","name":"Video Signalverarbeitung"},{"uid":705,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/videobasierte-fahrerassistenzsysteme.html","name":"Videobasierte Fahrerassistenzsysteme"},{"uid":975,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/virtual-reality.html","name":"Virtual Reality"},{"uid":789,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/virtuelle-kraftwerke.html","name":"Virtuelle Kraftwerke"},{"uid":987,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/vorbeugender-und-abwehrender-brandschutz.html","name":"Vorbeugender und abwehrender Brandschutz"},{"uid":393,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/vulnerabilitaet.html","name":"Vulnerabilit\u00e4t"},{"uid":1435,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/vuv-und-uvvis-spektroskopie-von-plasmen.html","name":"VUV-und UV\/VIS Spektroskopie von Plasmen"},{"uid":1675,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wahrnehmung.html","name":"Wahrnehmung"},{"uid":935,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wasserkraft-pumpspeicheranlagen-energiespeicher.html","name":"Wasserkraft, Pumpspeicheranlagen, Energiespeicher"},{"uid":693,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wellendigitalfilter-wdf.html","name":"Wave digital filters (WDF)"},{"uid":5,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/web-design.html","name":"Web Design"},{"uid":1145,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wellenleiter-solarzellen-konzentrator.html","name":"Wellenleiter Solarzellen Konzentrator"},{"uid":1343,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/werteforschung.html","name":"Werteforschung"},{"uid":1353,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/werteforschung-1.html","name":"Werteforschung"},{"uid":555,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wirkungs-und-rezeptionsgeschichte.html","name":"Wirkungs- und Rezeptionsgeschichte"},{"uid":1673,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wirkungsmechanismus-von-farbe-im-raum.html","name":"Wirkungsmechanismus von Farbe im Raum"},{"uid":1609,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wirtschaftsgeschichte.html","name":"Wirtschaftsgeschichte"},{"uid":1347,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wiss-begleitumg-und-evaluation-sozialer-programme-und-einrichtungen.html","name":"wiss. Begleitumg und Evaluation sozialer Programme und Einrichtungen"},{"uid":1339,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wissens-und-technologietransfer.html","name":"Wissens- und Technologietransfer"},{"uid":1683,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wissenschaft-im-kalten-krieg.html","name":"Wissenschaft im Kalten Krieg"},{"uid":243,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wissenschaftliche-bewertung.html","name":"Wissenschaftliche Bewertung"},{"uid":289,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wissenschaftliche-kreativitaet.html","name":"Wissenschaftliche Kreativit\u00e4t"},{"uid":669,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wissenschaftliches-rechnen.html","name":"Wissenschaftliches Rechnen"},{"uid":1677,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wissenschafts-und-technikgeschichte.html","name":"Wissenschafts- und Technikgeschichte"},{"uid":571,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wissenschaftsgeschichte-und-naturphilosophie.html","name":"Wissenschaftsgeschichte und Naturphilosophie"},{"uid":463,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wissenschaftstheorie-1.html","name":"Wissenschaftstheorie"},{"uid":547,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/wortschatzentwicklung-und-semantisch-lexikalische-stoerungen.html","name":"Wortschatzentwicklung und semantisch-lexikalische St\u00f6rungen"},{"uid":933,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/zeitreihenanalyse.html","name":"Zeitreihenanalyse"},{"uid":783,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/zellularer-ansatz.html","name":"Zellularer Ansatz"},{"uid":365,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/zustandsbewertung.html","name":"Zustandsbewertung"},{"uid":649,"url":"http:\/\/\/en\/scientistdatabase\/researchfocus\/show\/research\/zuverlaessigkeit-von-verteilungsnetzen.html","name":"Zuverl\u00e4ssigkeit"}],"lufs":[{"uid":108,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/3d-druck-additive-fertigung.html","name":"3D-Druck & Additive Fertigung"},{"uid":494,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/algebra-1.html","name":"Algebra"},{"uid":242,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/allgemeine-und-vergleichende-literaturwissenschaft.html","name":"Allgemeine und Vergleichende Literaturwissenschaft"},{"uid":608,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/alte-geschichte.html","name":"Alte Geschichte"},{"uid":700,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/alte-geschichte-1.html","name":"Alte Geschichte"},{"uid":612,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/amerikanistik.html","name":"Amerikanistik"},{"uid":380,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/angewandte-informatik.html","name":"Angewandte Informatik"},{"uid":370,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/angewandte-informatik-algorithmik.html","name":"Angewandte Informatik - Algorithmik"},{"uid":118,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/angewandte-mathematik.html","name":"Angewandte Mathematik"},{"uid":312,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/anglistik-kontrastive-linguistik-1.html","name":"Anglistik: Kontrastive Linguistik"},{"uid":542,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/arbeits-und-gesundheitsschutz.html","name":"Arbeits- und Gesundheitsschutz"},{"uid":152,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/arbeitswissenschaft-arbeitsmedizin.html","name":"Arbeitswissenschaft \/ Arbeitsmedizin"},{"uid":759,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/architekturgeschichte-und-theorie.html","name":"Architekturgeschichte und Theorie"},{"uid":514,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/astrophysik.html","name":"Astrophysik"},{"uid":294,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/atmosphaerenphysik.html","name":"Atmosph\u00e4renphysik"},{"uid":178,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/automatisierungstechnik-informatik.html","name":"Automatisierungstechnik \/ Informatik"},{"uid":596,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bahnsystemtechnik.html","name":"Bahnsystemtechnik"},{"uid":664,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/baubetrieb-und-bauwirtschaft-1.html","name":"Baubetrieb und Bauwirtschaft"},{"uid":176,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/baubetrieb-und-bauwirtschaft.html","name":"Baubetrieb und Bauwirtschaft"},{"uid":715,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/baudenkmalpflege.html","name":"Baudenkmalpflege"},{"uid":719,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/baudenkmalpflege-1.html","name":"Baudenkmalpflege"},{"uid":384,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/baukonstruktion-entwurf-materialkunde.html","name":"Baukonstruktion | Entwurf | Materialkunde"},{"uid":713,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/baukultur-und-raumgestaltung.html","name":"Baukultur und Raumgestaltung"},{"uid":721,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/baukultur-und-raumgestaltung-1.html","name":"Baukultur und Raumgestaltung"},{"uid":594,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/baumechanik-und-numerische-methoden.html","name":"Baumechanik und Numerische Methoden"},{"uid":88,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bauphysik-und-technische-gebaeudeausruestung.html","name":"Bauphysik und Technische Geb\u00e4udeausr\u00fcstung"},{"uid":402,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bauplanungsrecht-formelle-und-informelle-instrumente.html","name":"Bauplanungsrecht (formelle und informelle Instrumente)"},{"uid":44,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/berufsbildungsforschung.html","name":"Berufsbildungsforschung"},{"uid":647,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/betriebswirtschaftliche-steuerlehre.html","name":"Betriebswirtschaftliche Steuerlehre"},{"uid":180,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/betriebswirtschaftslehre-insb-innovation.html","name":"Betriebswirtschaftslehre, insb. Innovation"},{"uid":148,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bewegungs-und-trainingswissenschaft.html","name":"Bewegungs- und Trainingswissenschaft"},{"uid":639,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bibelwissenschaften.html","name":"Bibelwissenschaften"},{"uid":300,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bildgebende-systeme.html","name":"Bildgebende Systeme"},{"uid":622,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bildungsforschung-in-sambia.html","name":"Bildungsforschung in Sambia"},{"uid":626,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bildungsoekonomik.html","name":"Bildungs\u00f6konomik"},{"uid":651,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bildungsoekonomik-1.html","name":"Bildungs\u00f6konomik"},{"uid":606,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bildungsphilosophie-und-bildungsgeschichte.html","name":"Bildungsphilosophie und Bildungsgeschichte"},{"uid":226,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/bildungssprache-sprache-im-fachunterricht.html","name":"Bildungssprache, Sprache im Fachunterricht"},{"uid":244,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/boden-und-grundwassermanagement.html","name":"Boden- und Grundwassermanagement"},{"uid":698,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/buchmarkt-buchpolitik-und-verlagsgeschichten.html","name":"Buchmarkt, Buchpolitik und Verlagsgeschichten"},{"uid":204,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/experimentelle-elementarteilchenphysik.html","name":"Chemie"},{"uid":655,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/655.html","name":"Chemiedidaktik"},{"uid":86,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/chemische-sicherheit-und-abwehrender-brandschutz.html","name":"Chemische Sicherheit und Abwehrender Brandschutz"},{"uid":374,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/zoologie-und-didaktik-der-biologie-molekulare-evolution-protistologie-curriculare-unterrichtsfors.html","name":"Chloroplastengenom-Analysen, Intron-Analysen, Ciliaten als biologischer Filter in Kl\u00e4ranlagen, Algen als Symbiosen in Meeresnacktschnecken"},{"uid":771,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/computational-civil-engineering.html","name":"Computational Civil Engineering"},{"uid":356,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/computational-electromagnetics-1.html","name":"Computational Electromagnetics"},{"uid":338,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/computersimulation-fuer-brandschutz-und-fussgaengerverkehr.html","name":"Computersimulation f\u00fcr Brandschutz und Fu\u00dfg\u00e4ngerverkehr"},{"uid":36,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/controllling.html","name":"Controllling"},{"uid":436,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/curriculare-innovationsforschung.html","name":"Curriculare Innovationsforschung"},{"uid":334,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/darstellungsmethodik-und-entwerfen.html","name":"Darstellungsmethodik und Entwerfen"},{"uid":9,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/design-interaktiver-medien.html","name":"Design Interaktiver Medien"},{"uid":154,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/designwissenschaft.html","name":"Designwissenschaft"},{"uid":668,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/detektorentwicklung.html","name":"Detektorentwicklung"},{"uid":598,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-der-chemie.html","name":"Didaktik der Chemie"},{"uid":270,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-der-deutschen-sprache-und-literatur-sprachdidaktik.html","name":"Didaktik der deutschen Sprache und Literatur (Sprachdidaktik)"},{"uid":508,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-der-deutschen-sprache-und-literatur-schwerpunkt-literaturdidaktik.html","name":"Didaktik der deutschen Sprache und Literatur \/ Schwerpunkt Literaturdidaktik"},{"uid":182,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-der-mathematik.html","name":"Didaktik der Mathematik"},{"uid":490,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-der-musik.html","name":"Didaktik der Musik"},{"uid":586,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-der-technik-1.html","name":"Didaktik der Technik"},{"uid":212,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-der-technik.html","name":"Didaktik der Technik"},{"uid":122,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-des-englischen-1.html","name":"Didaktik des Englischen"},{"uid":330,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-des-franzoesischen.html","name":"Didaktik des Franz\u00f6sischen"},{"uid":676,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-des-lateinischen.html","name":"Didaktik des Lateinischen"},{"uid":678,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-des-lateinischen-1.html","name":"Didaktik des Lateinischen"},{"uid":725,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-des-sachunterrichts.html","name":"Didaktik des Sachunterrichts"},{"uid":126,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/didaktik-des-spanischen.html","name":"Didaktik des Spanischen"},{"uid":278,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/digital-humanities-mittelalterliche-geschichte.html","name":"Digital Humanities \/ Mittelalterliche Geschichte"},{"uid":398,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/digital-und-offsetdruck-industrieller-druck-funtionales-drucken.html","name":"Digital- und Offsetdruck \/Industrieller Druck \/Funtionales Drucken"},{"uid":396,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/digital-und-offsetdruckindustrielles-drucken.html","name":"Digital- und Offsetdruck\/Industrielles Drucken"},{"uid":631,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/digitale-medien.html","name":"Digitale Medien"},{"uid":734,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/digitalgestuetze-lehr-und-lernumgebungen.html","name":"Digitalgest\u00fctze Lehr- und Lernumgebungen"},{"uid":738,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/digitalisierung-1.html","name":"Digitalisierung"},{"uid":742,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/digitalisierung.html","name":"Digitalisierung"},{"uid":386,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/druckverfahrenstechnik.html","name":"Druckverfahrenstechnik"},{"uid":422,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/duennschichttechnologie.html","name":"D\u00fcnnschichttechnologie"},{"uid":428,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/duennschichttechnologie-1.html","name":"D\u00fcnnschichttechnologie"},{"uid":434,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/duennschichttechnologie-2.html","name":"D\u00fcnnschichttechnologie"},{"uid":442,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/duennschichttechnologie-3.html","name":"D\u00fcnnschichttechnologie"},{"uid":666,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/e-learning.html","name":"E-Learning"},{"uid":740,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/e-learning-1.html","name":"E-Learning"},{"uid":730,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/e-learning-bzw-die-entwicklung-und-gestaltung-von-vernetzten-und-digitalgestuetzen-lernumgebungen.html","name":"E-Learning bzw. die Entwicklung und Gestaltung von vernetzten und digitalgest\u00fctzen Lernumgebungen"},{"uid":256,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/editionswissenschaft.html","name":"Editionswissenschaft"},{"uid":174,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/elektrische-energieversorgung-2.html","name":"Elektrische Energieversorgung"},{"uid":70,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/elektrische-maschinen-und-antriebe.html","name":"Elektrische Maschinen und Antriebe"},{"uid":360,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/elektromagnetische-vertraeglichkeit-unter-umweltaspekten.html","name":"elektromagnetische Vertr\u00e4glichkeit unter Umweltaspekten"},{"uid":576,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/elektromobilitaet-1.html","name":"Elektromobilit\u00e4t"},{"uid":342,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/elektromobilitaet.html","name":"Elektromobilit\u00e4t"},{"uid":366,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/elektronik.html","name":"Elektronik"},{"uid":240,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/elektronische-medien.html","name":"Elektronische Medien"},{"uid":578,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/empirische-forschungsmethoden.html","name":"Empirische Forschungsmethoden"},{"uid":574,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/energiespeichersysteme.html","name":"Energiespeichersysteme"},{"uid":90,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/energietechnik.html","name":"Energietechnik"},{"uid":728,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/entwicklung-und-gestaltung-von-digitalgestuetzen-lernumgebungen-1.html","name":"Entwicklung und Gestaltung von digitalgest\u00fctzen Lernumgebungen"},{"uid":732,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/entwicklung-und-gestaltung-von-digitalgestuetzen-lernumgebungen.html","name":"Entwicklung und Gestaltung von digitalgest\u00fctzen Lernumgebungen"},{"uid":765,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/entwicklungspsychologie-der-lebensspanne.html","name":"Entwicklungspsychologie der Lebensspanne"},{"uid":628,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/erziehungswissenschaft-theorie-der-schule-allg-didaktik.html","name":"Erziehungswissenschaft (Theorie der Schule\/ Allg. Didaktik)"},{"uid":50,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/erziehungswissenschaft-mit-dem-schwerpunkt-berufs-und-weiterbildung.html","name":"Erziehungswissenschaft mit dem Schwerpunkt Berufs- und Weiterbildung"},{"uid":140,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/erziehungswissenschaft-mit-dem-schwerpunkt-geschlecht-und-diversitaet.html","name":"Erziehungswissenschaft mit dem Schwerpunkt Geschlecht und Diversit\u00e4t"},{"uid":500,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/erziehungswissenschaft-mit-dem-schwerpunkt-kindheitsforschung-1.html","name":"Erziehungswissenschaft mit dem Schwerpunkt Kindheitsforschung"},{"uid":618,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/ethik.html","name":"Ethik"},{"uid":566,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/evidenz-basierte-forschung.html","name":"Evidenz basierte Forschung"},{"uid":416,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/evidenzbasierte-forschung.html","name":"Evidenzbasierte Forschung"},{"uid":659,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/experimentallehre.html","name":"Experimentallehre"},{"uid":653,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/experimentalunterricht.html","name":"Experimentalunterricht"},{"uid":717,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/farbstrategien-in-der-architektur.html","name":"Farbstrategien in der Architektur"},{"uid":682,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/farbtechnik-raumgestaltung-oberflaechentechnik.html","name":"Farbtechnik\/ Raumgestaltung\/ Oberfl\u00e4chentechnik"},{"uid":662,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/feedback-und-kommunikation.html","name":"Feedback und Kommunikation"},{"uid":686,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/experimentalphysik-kondensierte-materie.html","name":"Festk\u00f6rperphysik"},{"uid":637,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/finanzmathematik.html","name":"Finanzmathematik"},{"uid":230,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/finanzwirtschaft-und-corporate-governance.html","name":"Finanzwirtschaft und Corporate Governance"},{"uid":624,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/finanzwissenschaft.html","name":"Finanzwissenschaft"},{"uid":649,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/finanzwissenschaft-1.html","name":"Finanzwissenschaft"},{"uid":372,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/forschung-molekulare-evolution-der-euglenozoa.html","name":"Forschung: Molekulare Evolution der Euglenozoa, Chloroplastengenom-Analysen, Intron-Analysen"},{"uid":114,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/romanische-sprachwissenschaft-fruehkindliche-mehrsprachigkeit.html","name":"Fr\u00fchkindliche Mehrsprachigkeit"},{"uid":767,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/funktionalanalysis.html","name":"Funktionalanalysis"},{"uid":751,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/geographie.html","name":"Geographie"},{"uid":534,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/geotechnik.html","name":"Geotechnik"},{"uid":268,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/germanistik.html","name":"Germanistik"},{"uid":510,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/germanistik-didaktik-der-deutschen-sprache-und-literatur-schwerpunkt-literatur.html","name":"Germanistik \/ Didaktik der deutschen Sprache und Literatur \/ Schwerpunkt Literatur"},{"uid":582,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/germanistik-didaktik-der-deutschen-sprache-und-literatur-schwerpunkt-sprachdidaktik.html","name":"Germanistik \/ Didaktik der deutschen Sprache und Literatur \/ Schwerpunkt: Sprachdidaktik"},{"uid":170,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/germanistische-sprachwissenschaft.html","name":"Germanistische Sprachwissenschaft"},{"uid":64,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/geschichte-der-fruehen-neuzeit.html","name":"Geschichte der Fr\u00fchen Neuzeit"},{"uid":552,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/geschlechterkonstruktionen-im-sport.html","name":"Geschlechterkonstruktionen im Sport"},{"uid":56,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/gestaltungstechnik-und-kunstgeschichte.html","name":"Gestaltungstechnik und Kunstgeschichte"},{"uid":556,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/gesundheitsoekonomie-1.html","name":"Gesundheits\u00f6konomie"},{"uid":250,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/gesundheitsoekonomie.html","name":"Gesundheits\u00f6konomie"},{"uid":558,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/gesundheitsoekonomie-und-versorgungsforschung.html","name":"Gesundheits\u00f6konomie und Versorgungsforschung"},{"uid":630,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/grundschulforschung.html","name":"Grundschulforschung"},{"uid":332,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/gueterverkehrsplanung-und-transportlogistik.html","name":"G\u00fcterverkehrsplanung und Transportlogistik"},{"uid":516,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/516.html","name":"Hadronen- und Kernphysik"},{"uid":520,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/520.html","name":"Hadronen- und Kernphysik"},{"uid":544,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/handlungs-und-interaktionstheorien.html","name":"Handlungs- und Interaktionstheorien"},{"uid":550,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/historische-hilfswissenschaften.html","name":"Historische Hilfswissenschaften"},{"uid":641,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/historische-theologie.html","name":"Historische Theologie"},{"uid":506,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/historisches-seminar.html","name":"Historisches Seminar"},{"uid":406,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/human-engineering.html","name":"Human Engineering"},{"uid":709,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/innovationsmanagement-und-nachhaltigkeit.html","name":"Innovationsmanagement und Nachhaltigkeit"},{"uid":711,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/innovationsmanagement-und-nachhaltigkeit-2.html","name":"Innovationsmanagement und Nachhaltigkeit"},{"uid":560,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/institutionen-und-prozesse-der-sozialisation.html","name":"Institutionen und Prozesse der Sozialisation"},{"uid":168,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/integrative-theorie-und-praxis-des-sports.html","name":"Integrative Theorie und Praxis des Sports"},{"uid":254,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/interface-und-user-experience-design.html","name":"Interface- und User Experience-Design"},{"uid":674,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/international-economics.html","name":"International Economics"},{"uid":104,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/internationale-beziehungen-friedens-und-konfliktforschung.html","name":"Internationale Beziehungen \/ Friedens- und Konfliktforschung"},{"uid":390,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/internationale-beziehungen-und-vergleichende-politikwissenschaften.html","name":"Internationale Beziehungen und vergleichende Politikwissenschaften"},{"uid":562,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/internationale-beziehungen-und-vergleichende-politikwissenschaften-sowie-sozial-oekologische-transfor.html","name":"Internationale Beziehungen und vergleichende Politikwissenschaften sowie sozial-\u00f6kologische Transformationsforschung"},{"uid":106,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/internet-der-dinge.html","name":"Internet der Dinge"},{"uid":755,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/jazzgesang.html","name":"Jazzgesang"},{"uid":346,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/kindheitssoziologie.html","name":"Kindheitssoziologie"},{"uid":522,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/klassische-philologie.html","name":"Klassische Philologie"},{"uid":763,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/klinische-psychologie-und-psychotherapie.html","name":"Klinische Psychologie und Psychotherapie"},{"uid":688,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/kognitive-neurowissenschaft.html","name":"Kognitive Neurowissenschaft"},{"uid":614,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/kognitive-neurowissenschaften.html","name":"Kognitive Neurowissenschaften"},{"uid":670,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/kommunikationstechnik.html","name":"Kommunikationstechnik"},{"uid":318,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/konstruktion-engineering-design.html","name":"Konstruktion (Engineering Design)"},{"uid":723,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/kunst-mit-dem-schwerpunkt-kuenstlerische-praxis.html","name":"Kunst mit dem Schwerpunkt k\u00fcnstlerische Praxis"},{"uid":727,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/kunst-mit-dem-schwerpunkt-kuenstlerische-praxis-2.html","name":"Kunst mit dem Schwerpunkt k\u00fcnstlerische Praxis"},{"uid":749,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/kunstdidaktik.html","name":"Kunstdidaktik"},{"uid":590,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/kunstpaedagogik.html","name":"Kunstp\u00e4dagogik"},{"uid":548,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/l2-l3-spracherwerb.html","name":"L2-\/L3-Spracherwerb"},{"uid":46,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/latinistik.html","name":"Latinistik"},{"uid":382,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/lehr-lern-und-unterrichsforschung.html","name":"Lehr-, Lern- und Unterrichsforschung"},{"uid":757,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/lehrerbeurteilung.html","name":"Lehrerbeurteilung"},{"uid":116,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/lehrerbildung-fuer-schulische-inklusion.html","name":"Lehrerbildung f\u00fcr Schulische Inklusion"},{"uid":572,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/lehrstuhl-fuer-neue-fertigungstechnologien-und-werkstoffe.html","name":"Lehrstuhl f\u00fcr Neue Fertigungstechnologien und Werkstoffe"},{"uid":747,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/lehrstuhl-fuer-stahl-und-verbundkonstruktionen.html","name":"Lehrstuhl f\u00fcr Stahl- und Verbundkonstruktionen"},{"uid":470,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/literatur-und-medienwissenschaft.html","name":"Literatur- und Medienwissenschaft"},{"uid":696,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/literaturgeschichte-rezeptionsgeschichte-und-kanonisierungsprozesse.html","name":"Literaturgeschichte, Rezeptionsgeschichte und Kanonisierungsprozesse"},{"uid":466,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/makromolekulare-chemie-1.html","name":"Makromolekulare Chemie"},{"uid":486,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/makrooekonomik.html","name":"Makro\u00f6konomik"},{"uid":712,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/management-chemischer-prozesse-in-der-industrie.html","name":"Management chemischer Prozesse in der Industrie"},{"uid":32,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/manufacturing-and-material-science-schwerpunkt-konstruktionstechnik-und-systematik-im-design.html","name":"Manufacturing and Material Science, Schwerpunkt Konstruktionstechnik und -systematik im Design"},{"uid":504,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/maschinenbau-informatik.html","name":"Maschinenbau-Informatik"},{"uid":388,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/massivbau.html","name":"Massivbau"},{"uid":34,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/materialwissenschaft-und-werkstofftechnik.html","name":"Materialwissenschaft und Werkstofftechnik"},{"uid":316,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/mathematik-analysis-und-mathematische-systemtheorie.html","name":"Mathematik: Analysis und mathematische Systemtheorie"},{"uid":348,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/mathematische-optimierung.html","name":"Mathematische Optimierung"},{"uid":635,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/mathematische-physik.html","name":"mathematische Physik"},{"uid":166,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/matthaeusevangelium.html","name":"Matth\u00e4usevangelium"},{"uid":134,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/mechatronik.html","name":"Mechatronik"},{"uid":258,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/medienoekonomie-innovationsmamagement.html","name":"Medien\u00f6konomie \/ Innovationsmamagement"},{"uid":610,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/medienwissenschaft.html","name":"Medienwissenschaft"},{"uid":192,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/methoden-der-sicherheitstechnik-unfallforschung.html","name":"Methoden der Sicherheitstechnik \/ Unfallforschung"},{"uid":298,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/methodenlehre-und-psychologische-diagnostik.html","name":"Methodenlehre und Psychologische Diagnostik"},{"uid":210,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/mittelalterliche-geschichte-1.html","name":"Mittelalterliche Geschichte"},{"uid":524,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/molekulare-pflanzenforschungpflanzenbiochemie-botanik.html","name":"Molekulare Pflanzenforschung\/Pflanzenbiochemie (Botanik)"},{"uid":272,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/multi-channel-management.html","name":"Multi-Channel-Management"},{"uid":588,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/musikwissenschaft.html","name":"Musikwissenschaft"},{"uid":602,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/musikwissenschaft-musikpaedagogik.html","name":"Musikwissenschaft \/ Musikp\u00e4dagogik"},{"uid":600,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/musikwissenschaft-popular-music-studies.html","name":"Musikwissenschaft \/ Popular Music Studies"},{"uid":42,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/neue-fertigungstechnologien-und-werkstoffe.html","name":"Neue Fertigungsverfahren und Werkstoffe"},{"uid":472,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/neuere-deutsche-literaturgeschichte.html","name":"Neuere deutsche Literaturgeschichte"},{"uid":692,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/neuere-geschichte.html","name":"Neuere Geschichte"},{"uid":196,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/neues-testament-geschichte-der-alten-kirche.html","name":"Neues Testament, Geschichte der Alten Kirche"},{"uid":96,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/oeffentliche-verkehrssysteme-und-mobilitaetsmanagement.html","name":"\u00d6ffentliche Verkehrssysteme und Mobilit\u00e4tsmanagement"},{"uid":744,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/oeffentliches-recht.html","name":"\u00d6ffentliches Recht"},{"uid":746,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/oeffentliches-recht-2.html","name":"\u00d6ffentliches Recht"},{"uid":643,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/oekonometrie-1.html","name":"\u00d6konometrie"},{"uid":645,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/oekonometrie.html","name":"\u00d6konometrie"},{"uid":82,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/oekonomie-des-planens-und-bauens.html","name":"\u00d6konomie des Planens und Bauens"},{"uid":302,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/optimierung-mechanischer-strukturen.html","name":"Optimierung mechanischer Strukturen"},{"uid":424,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/opto-und-nanoelektronik.html","name":"Opto- und Nanoelektronik"},{"uid":430,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/opto-und-nanoelektronik-1.html","name":"Opto- und Nanoelektronik"},{"uid":432,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/opto-und-nanoelektronik-2.html","name":"Opto- und Nanoelektronik"},{"uid":440,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/opto-und-nanoelektronik-3.html","name":"Opto- und Nanoelektronik"},{"uid":146,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/organisations-und-wissenschaftssoziologie.html","name":"Organisations- und Wissenschaftssoziologie"},{"uid":530,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/organische-chemie.html","name":"Organische Chemie"},{"uid":138,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/organizational-behavior.html","name":"Organizational Behavior"},{"uid":72,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/paedagogische-diagnostik.html","name":"P\u00e4dagogische Diagnostik"},{"uid":736,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/entwicklung-und-gestaltung-digitalgestuetzter-lernumgebungen.html","name":"P\u00e4dagogische Psychologie und digitale Lernmedien"},{"uid":252,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/parallele-hard-und-softwaresysteme.html","name":"Parallele Hard- und Softwaresysteme"},{"uid":136,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/personalmanagement.html","name":"Personalmanagement"},{"uid":404,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/personalpsychologie.html","name":"Personalpsychologie"},{"uid":296,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/philosophie-der-physik.html","name":"Philosophie der Physik"},{"uid":438,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/photochemie-in-der-lehre-der-mint-faecher.html","name":"Photochemie in der Lehre der MINT-F\u00e4cher"},{"uid":74,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/physikalische-chemie-massenspektrometrie-plasmen.html","name":"physical chemistry, mass spectrometry and plasmas"},{"uid":426,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/physik-und-ihre-didaktik.html","name":"Physik und ihre Didaktik"},{"uid":328,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/physikalische-chemie.html","name":"Physikalische Chemie"},{"uid":502,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/physikalische-chemie-1.html","name":"Physikalische Chemie"},{"uid":769,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/planung-und-entscheidung-im-gesundheitsmanagement.html","name":"Planung und Entscheidung im Gesundheitsmanagement"},{"uid":54,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/politische-soziologie.html","name":"Politische Soziologie"},{"uid":672,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/politisches-system-der-bundesrepublik.html","name":"Politisches System der Bundesrepublik"},{"uid":98,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/postcolonial-languages-studies.html","name":"Postcolonial Languages Studies"},{"uid":684,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/praktische-philosophie.html","name":"Praktische Philosophie"},{"uid":414,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/praeventivmedizin.html","name":"Pr\u00e4ventivmedizin"},{"uid":418,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/praeventivmedizin-1.html","name":"Pr\u00e4ventivmedizin"},{"uid":420,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/produktion-und-logistik.html","name":"Produktion und Logistik"},{"uid":264,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/produktsicherheit-und-qualitaetswesen.html","name":"Produktsicherheit und Qualit\u00e4tswesen"},{"uid":707,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/prozesschemie-und-analytische-chemie.html","name":"Prozesschemie und Analytische Chemie"},{"uid":584,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/psychologie.html","name":"Psychologie"},{"uid":616,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/psychologie-1.html","name":"Psychologie"},{"uid":110,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/quantitative-methoden-der-empirischen-sozialforschung-und-sozialstrukturanalyse.html","name":"Quantitative Methoden der empirischen Sozialforschung und Sozialstrukturanalyse"},{"uid":592,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/regelungstechnik.html","name":"Regelungstechnik"},{"uid":68,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/regenerative-energiesysteme.html","name":"Regenerative Energiesysteme"},{"uid":454,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/reine-mathematik-komplexe-analysis.html","name":"Reine Mathematik \/ Komplexe Analysis"},{"uid":216,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/religionspaedagogik-katechetik-und-didaktik-des-kath-religionsunterrichts.html","name":"Religionsp\u00e4dagogik \/ Katechetik und Didaktik des Kath. Religionsunterrichts"},{"uid":482,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/religionspaedagogik-und-didaktik-der-ev-religionslehre.html","name":"Religionsp\u00e4dagogik und Didaktik der Ev. Religionslehre"},{"uid":546,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/risikoanalyse.html","name":"Risikoanalyse"},{"uid":480,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/romanische-sprachwissenschaft-mehrsprachigkeitsforschung.html","name":"Romanische Sprachwissenschaft, Mehrsprachigkeitsforschung"},{"uid":761,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/romanistik-sprachwissenschaft.html","name":"Romanistik - Sprachwissenschaft"},{"uid":206,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/romanistische-literaturwissenschaft.html","name":"Romanistische Literaturwissenschaft"},{"uid":456,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/schulische-interventionsforschung.html","name":"Schulische Interventionsforschung"},{"uid":528,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/schulische-interventionsforschung-bei-besonderen-paedagogischen-beduerfnissen.html","name":"Schulische Interventionsforschung bei besonderen p\u00e4dagogischen Bed\u00fcrfnissen"},{"uid":446,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/schulpaedagogik.html","name":"Schulp\u00e4dagogik"},{"uid":132,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/schultheorie-und-schulentwicklung-1.html","name":"Schultheorie und Schulentwicklung"},{"uid":8,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/wissenschaftliches-rechnen-softwaretechnologie.html","name":"Scientific Computing \/ Software Engineering"},{"uid":498,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sicherheitsforschung.html","name":"Sicherheitsforschung"},{"uid":10,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sicherheitstechnik-arbeitssicherheit.html","name":"Sicherheitstechnik \/ Arbeitssicherheit"},{"uid":40,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sicherheitstechnik-umweltschutz.html","name":"Sicherheitstechnik \/ Umweltschutz"},{"uid":526,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sonderpaedagogik-1.html","name":"Sonderp\u00e4dagogik"},{"uid":94,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sonderpaedagogik.html","name":"Sonderp\u00e4dagogik"},{"uid":376,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sonderpaedagogische-psychologie.html","name":"Sonderp\u00e4dagogische Psychologie"},{"uid":378,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sonderpaedagogische-psychologie-1.html","name":"Sonderp\u00e4dagogische Psychologie"},{"uid":60,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sozialpaedagogik-soziale-dienste.html","name":"Sozialp\u00e4dagogik \/ Soziale Dienste"},{"uid":92,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sozialpsychologie.html","name":"Sozialpsychologie"},{"uid":538,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sportdidaktik.html","name":"Sportdidaktik"},{"uid":540,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sportdidaktik-2.html","name":"Sportdidktik"},{"uid":512,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sportmedizin.html","name":"Sportmedizin"},{"uid":324,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sportpaedagogik.html","name":"Sportp\u00e4dagogik"},{"uid":280,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sportwissenschaft.html","name":"Sportwissenschaft"},{"uid":536,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/sportwissenschaft-1.html","name":"Sportwissenschaft"},{"uid":228,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/spracherwerb-und-sozialisation-linguistische-unterrichtsforschung-sprachdidaktik.html","name":"Spracherwerb und -sozialisation, linguistische Unterrichtsforschung, Sprachdidaktik"},{"uid":753,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/stimmbildung-singen-mit-kindern.html","name":"Stimmbildung - Singen mit Kindern"},{"uid":633,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/stochastische-analysis.html","name":"Stochastische Analysis mit Anwendungen"},{"uid":336,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/strassenverkehrsplanung-und-technik.html","name":"Stra\u00dfenverkehrsplanung und -technik"},{"uid":690,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/strategic-design.html","name":"Strategic Design"},{"uid":444,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/stressforschung.html","name":"Stressforschung"},{"uid":78,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/stroemungs-und-thermodynamik-1.html","name":"Str\u00f6mungs- und Thermodynamik"},{"uid":604,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/systematische-theologie.html","name":"Systematische Theologie"},{"uid":694,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/systematische-theologie-1.html","name":"Systematische Theologie"},{"uid":260,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/systematische-theologie-und-religionswissenschaft.html","name":"Systematische Theologie und Religionswissenschaft"},{"uid":288,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/systemforschung-ikt-innovationsstrategien.html","name":"Systemforschung IKT \/ Innovationsstrategien"},{"uid":702,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/technologien-und-management-der-digitalen-transformation-1.html","name":"Technologien und Management der Digitalen Transformation"},{"uid":704,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/technologien-und-management-der-digitalen-transformation.html","name":"Technologien und Management der Digitalen Transformation"},{"uid":706,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/technologienmanagement-der-digitalen-transformation.html","name":"Technologien\/Management der Digitalen Transformation"},{"uid":518,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/518.html","name":"Teilchenphysik"},{"uid":410,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/theoretical-chemical-physics.html","name":"Theoretical chemical Physics"},{"uid":344,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/theoretische-molekuelspektroskopie.html","name":"Theoretical Molecular Spectroscopy"},{"uid":408,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/theoretische-chemische-physik.html","name":"Theoretische chemische Physik"},{"uid":488,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/theoretische-elementarteilchenphysik.html","name":"Theoretische Elementarteilchenphysik"},{"uid":38,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/theoretische-nachrichtentechnik-signalverarbeitung.html","name":"Theoretische Nachrichtentechnik, Signalverarbeitung"},{"uid":320,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/theoretische-physik.html","name":"Theoretische Physik"},{"uid":394,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/theoretische-physik-1.html","name":"Theoretische Physik"},{"uid":128,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/theorie-und-anwendung-mehrdimensionaler-signale-und-systeme.html","name":"Theorie und Anwendung mehrdimensionaler Signale und Systeme"},{"uid":262,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/theorie-und-geschichte-der-wissenschaften.html","name":"Theorie und Geschichte der Wissenschaften"},{"uid":458,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/topologie.html","name":"Topologie"},{"uid":460,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/topologie-1.html","name":"Topologie"},{"uid":462,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/topologie-2.html","name":"Topologie"},{"uid":474,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/topologie-3.html","name":"Topologie"},{"uid":208,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/tragwerklehre-und-baukonstruktion.html","name":"Tragwerklehre und Baukonstruktion"},{"uid":362,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/transferstelle.html","name":"Transferstelle"},{"uid":392,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/transformationsforschung-und-nachhaltigkeit.html","name":"Transformationsforschung und Nachhaltigkeit"},{"uid":564,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/umweltmedizin.html","name":"Umweltmedizin"},{"uid":66,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/umweltvertraegliche-infrastrukturplanung-stadtbauwesen.html","name":"Umweltvertr\u00e4gliche Infrastrukturplanung, Stadtbauwesen"},{"uid":568,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/uniservice-transfer.html","name":"UNISERVICE TRANSFER"},{"uid":58,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/unternehmensgruendung-und-wirtschaftsentwicklung.html","name":"Unternehmensgr\u00fcndung und Wirtschaftsentwicklung"},{"uid":580,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/unternehmensgruendung-und-wirtschaftsentwicklung-1.html","name":"Unternehmensgr\u00fcndung und Wirtschaftsentwicklung"},{"uid":657,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/verkehrssicherheit-und-zuverlaessigkeit.html","name":"Verkehrssicherheit und Zuverl\u00e4ssigkeit"},{"uid":661,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/verkehrssicherheit-und-zuverlaessigkeit-2.html","name":"Verkehrssicherheit und Zuverl\u00e4ssigkeit"},{"uid":368,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/druckweiterverarbeitung-und-verpackungstechnik.html","name":"Verpackung"},{"uid":554,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/versorgungsforschung.html","name":"Versorgungsforschung"},{"uid":340,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/wasserwirtschaft-und-wasserbau.html","name":"Wasserwirtschaft und Wasserbau"},{"uid":570,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/werkstofftechnik.html","name":"Werkstofftechnik"},{"uid":620,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/werkstofftechnik-1.html","name":"Werkstofftechnik"},{"uid":102,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/wirtschaftsinforamtik-und-operations-research.html","name":"Wirtschaftsinforamtik und Operations Research"},{"uid":84,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/wissenschaftsgeschichte.html","name":"Wissenschaftsgeschichte"},{"uid":412,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/wissenschaftstransferstelle.html","name":"Wissenschaftstransferstelle"},{"uid":532,"url":"http:\/\/\/en\/scientistdatabase\/luf\/show\/professorships\/www.html","name":"WWW"}]}